(data stored in SCRATCH zone)

EMBL: CP001887.PE718

CP001887.PE718       Location/Qualifiers
FT   CDS_pept        790364..791209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03645"
FT                   /product="putative chromosome partitioning protein"
FT                   /note="COG1475 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03645"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18406"
FT                   /protein_id="ADH18406.1"
FT                   /translation="MSRLPSEDTLLEVNIEDIRVSPFQPRRTFLEEDLKELVLSIKTVG
FT                   LIHPPVVREIRNGDKVLYYELIAGERRWRALQLAGYKTVPVVLKQVLADDMAAEATLIE
FT                   NIQRVNLNPLEMAEAFRRLIVVFGLTQDKVAKKVGKKRSTVANYLRLFSLPQEVQEKMN
FT                   SGEISLGHAKVILSLEDENLRQILSQKIISCKLAVREAEMEAKRLVKGKGASLKEDSSS
FT                   QPSSRLGFCQERLATTFGYPVTVKPQGRRICVSFFVEGEEALEALEKALTTSSSEAILT
FT                   "
     gtgagtagat tacctagcga agatacactt ttagaagtga atatagagga catccgggtc        60
     agcccttttc aacctcgacg tacatttctt gaggaagatt taaaagaatt agttctttct       120
     atcaagacgg taggactgat tcatcctcct gtagttaggg agatccgtaa tggggataag       180
     gttttgtatt atgagttaat agctggtgag cgtcgttggc gcgccttgca attagcagga       240
     tataaaacgg tccctgttgt tttgaagcag gtgctagctg atgatatggc agcagaggcg       300
     actttaatag aaaatatcca aagggtaaac ctgaaccctt tagaaatggc agaagctttt       360
     cgacgtttga ttgttgtttt tggtcttacc caagataagg ttgctaaaaa agttgggaag       420
     aagcgttcga cagtagctaa ttatctgcgt ttgttctctc ttcctcaaga ggtccaagaa       480
     aaaatgaact ctggagagat ctctttaggg catgccaaag tcatcttatc gttggaagat       540
     gaaaatctta gacagattct gagtcagaaa attatctcct gcaagttagc agtacgcgaa       600
     gcagagatgg aggctaaacg tctagtgaaa ggtaaaggag cttctttgaa agaagacagt       660
     tcttcacaac cttcttctcg actagggttt tgtcaagaac ggttagcaac aacctttggc       720
     tatcctgtaa cggtaaagcc tcagggaaga cgcatatgcg tatcattttt tgtagaagga       780
     gaggaagcgt tagaagcttt ggaaaaagct ttaacaacat cttcttctga agctatctta       840
     acttaa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page