(data stored in SCRATCH zone)

EMBL: CP001887.PE743

CP001887.PE743       Location/Qualifiers
FT   CDS_pept        823991..825163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03770"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18431"
FT                   /protein_id="ADH18431.1"
FT                   /translation="MRNHPIPEGQKYFVPTIETAAPRERRVSPAEVAADYTQLHEAATY
FT                   LQVFQDLLNDAHQLGLNKEFVESLRQDFLKTGSEMSLMQALWTEESQREARKRERKELQ
FT                   QQLESKVLGPQALTTAEELHPVDDSIVNKMPFQSAFAYILLDKYIPAQEEALYALAREL
FT                   SFSGYAQTLFSPVLELVKSFNNAPIVYNLGSYIGQTAGTANFKYGYQMVLDRYETETGQ
FT                   LRKDIKNAENAKQQLAQIIKNIEANNSLTTEHKTQLKDMANGYIQTLDVCISQMQELST
FT                   GLRGLSFIPGRDEYSPAYEIMGSSFSVVTLQNLEGKVVDGEINISSGETKGGLLNFFTY
FT                   FLADVQNFGDLAQTNQLMLELQMRAMHQQWSLVTASLKLLHNVYRTLASS"
     atgagaaacc atccgattcc agaaggacaa aagtattttg ttccaacaat agagactgcg        60
     gctcctcgag aacgcagagt ctcccctgca gaagtagcag ccgactacac gcagttgcat       120
     gaggcggcaa cgtatcttca agtatttcaa gatttattga acgatgcgca tcagttagga       180
     ctaaataaag agttcgtaga gagtttgcgt caagatttct taaaaacagg ctccgagatg       240
     tctttgatgc aagctctatg gactgaagag agtcaaagag aagcgcgtaa gagagagaga       300
     aaagagctcc agcaacaact agagtccaag gtactaggtc ctcaggcatt aacgactgct       360
     gaggagttgc atcctgtgga tgatagtatt gtgaataaga tgccttttca atcggctttt       420
     gcgtatatcc ttcttgataa gtatattcct gcacaggaag aggctctgta tgcattagca       480
     agagagctca gtttttcagg gtatgcacag acattattta gcccagtttt agagttagtg       540
     aaaagtttta ataacgcgcc tatcgtttac aacttaggct cttacattgg gcagacagca       600
     ggaactgcga actttaaata tggctatcag atggtcttgg atcgttatga aacagagact       660
     ggccagttga gaaaggatat taaaaatgct gagaatgcca agcagcagct ggcacagatt       720
     attaagaaca tagaggcaaa taattcttta acgacagagc acaagactca gctcaaggat       780
     atggcaaatg ggtatattca gactttagat gtctgtatct cccaaatgca agagctgtct       840
     actggattgc gaggattatc atttatccct ggtagagatg aatacagccc tgcttatgag       900
     attatgggat cttctttttc cgtagttact ttacaaaact tggaagggaa ggttgtcgat       960
     ggggagatca atatttcctc tggagaaacg aaaggtgggc ttttaaactt ctttacctat      1020
     tttcttgcag acgtacagaa ttttggagat ttagcacaaa cgaatcagtt gatgttagaa      1080
     ctacaaatgc gagctatgca tcagcaatgg agtttagtta cagcctctct gaaactctta      1140
     cataatgtat atagaacatt ggcttctagc tag                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page