(data stored in SCRATCH zone)

EMBL: CP001887.PE750

CP001887.PE750       Location/Qualifiers
FT   CDS_pept        complement(830989..831993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03805"
FT                   /product="type III secretion system protein"
FT                   /note="COG1766 Flagellar biosynthesis/type III secretory
FT                   pathway lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03805"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18438"
FT                   /protein_id="ADH18438.1"
FT                   /translation="MPVLPRFLKNKIASTKSLGYLLAAILIGFIMLYKPSSPQPTPTVA
FT                   STEKKPSHWLKLSHLGNLQSIEIQAKKEQLEKDLTLFEPVLQATVALSQEEDSLAEISV
FT                   ILSLPQASTLSPSLVHSITDYLTRSVPGLTKEHITLSDQHGNLYSPLFEQSNTLLTTSL
FT                   ERSLQTILPQTHFALNYIPVADEGHLQLLVDEDYLNTLPKGARVKLLSHMQEILSAFPE
FT                   MHPSVDIVPFLKPVAHKTSRLSSIVLSITIVLLSLGILGFATFYLAFHTYDHVSQQKEK
FT                   IQSINIPKLIEMMKRESPEKVALILSYLDSAKAEELLNKLPEEMKSAVLKLRT"
     atgccggtgc tacctcgctt tctaaaaaat aagatcgcct ccactaaatc tttaggctac        60
     cttcttgcag ctattcttat tggcttcatc atgttgtata aaccatcctc tcctcagcct       120
     acccctactg tagcctctac agagaaaaaa ccctcacatt ggctgaagct ctcccattta       180
     gggaatcttc aatcgataga aatccaagca aagaaagagc aattagaaaa agatctgact       240
     ctatttgagc ctgtgctcca agcaacggtt gctctatccc aagaagaaga ctccttagca       300
     gaaatctccg tgatcctttc tcttcctcag gcttcgacat tatccccatc actcgtgcac       360
     tcaatcactg attacctgac acgcagcgtc cctgggttaa ctaaagaaca tatcaccttg       420
     tccgatcagc atggtaatct ctactcccct ctcttcgaac aaagtaatac cctactcact       480
     acctcattag aacgctcact acaaacgatt cttcctcaaa cgcatttcgc cttaaactat       540
     attcctgtag cggatgaagg ccatttgcaa cttctcgtcg atgaggacta cctcaatact       600
     cttcctaaag gtgcacgtgt taagttgctc tcgcatatgc aagagattct ctcagcattc       660
     ccagaaatgc atccgtctgt agatattgtc cctttcctaa aacccgtagc acacaaaact       720
     tctcgcctat cctcaattgt cttgagtatt actattgtgt tactaagcct tggaattcta       780
     ggctttgcta ccttctatct tgcttttcat acctatgacc atgtctctca acagaaagaa       840
     aaaatacaga gcataaatat accaaagctg atagagatga tgaaaagaga atccccagaa       900
     aaagttgcat tgattctctc ctatctagac tcagcaaaag cggaagaact tcttaataaa       960
     cttcctgaag aaatgaagag tgctgtgtta aagttaagaa cataa                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page