(data stored in SCRATCH zone)

EMBL: CP001887.PE765

CP001887.PE765       Location/Qualifiers
FT   CDS_pept        complement(845436..846782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03880"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18453"
FT                   /protein_id="ADH18453.1"
FT                   /translation="MLINFTFRNCLLFLVTLSSVPVFSAPQPRGTLPSSTTKIGSEVWI
FT                   EQKVRQYPELLWLVEPSSTGASLKSPSGAIFSPTLFQKKVPAFDIAVRSLIHLHLLIQG
FT                   SRQAYAQLIQLQTSESPLTFKQFLALHKQLTLFLNSPKEFYDSVKVLETAIVLRHLGCS
FT                   TKAVAAFKPYFSEMQREAFYTKALHVLHTFPELSPSFARLSPEQKTLFFSLRKLANYDE
FT                   LLSLTNTPSFQLLSAGRSQRALLALDLYLYALDSCGEQGMSSQFHTNFAPLQSMLQQYA
FT                   TVEEAFSRYFTYRANRLGFDGSSRSEMALVRMATLMNLPPSEAAILTTSFKTLPTEEAD
FT                   TLVNSFYTNKGDSLALSLRGLPTLVSELTRTAHGNTNAEARSQQIYATTLSLVVKSLKA
FT                   HKEMLNKQILSKEIVLDFSETAASCQGLDIFSENVAVQIHLNGTVSIHL"
     atgttaataa actttacctt tcgcaactgt cttttgttcc ttgtcacact gtctagtgtc        60
     cctgttttct cagcacctca acctcgcgga acgcttccta gctcgaccac aaaaattgga       120
     tcagaagttt ggattgaaca aaaagtccgc caatatccag agcttttatg gttagtagag       180
     ccgtcctcta cgggagcctc tttaaaatct ccttcaggag ccatcttttc tccaacatta       240
     ttccaaaaaa aggtccctgc tttcgatatc gcagtgcgca gtttgattca cttacattta       300
     ttaatccagg gttcccgcca agcctatgct caactgatcc aactacagac cagcgaatcc       360
     cctctaacat ttaagcaatt ccttgcattg cataagcaat taactctatt tttaaattcc       420
     cctaaggaat tttatgactc tgttaaagtg ttagagacag ctatcgtctt acgtcactta       480
     ggctgttcaa ctaaggctgt tgctgcgttt aaaccttatt tctcagaaat gcaaagagag       540
     gctttttaca ctaaggctct gcatgtacta cacaccttcc cagagctaag cccatcattt       600
     gctcgcctct ctccggagca gaaaactctc ttcttctcct tgagaaaatt ggcgaattac       660
     gatgagttac tctcgctgac gaacacccca agttttcagc ttctgtctgc tgggcgctcg       720
     caacgagctc ttttagctct ggacttgtac ctctatgctt tggattcctg tggagaacag       780
     gggatgtcct ctcaattcca cacaaacttc gcacctctac agtccatgtt gcaacaatac       840
     gctactgtag aagaggcctt ttctcgttat tttacttacc gagctaatcg attaggattt       900
     gatggctctt ctcgatccga gatggcttta gtaagaatgg ccaccttgat gaacttgcct       960
     ccttccgaag ctgcgatttt aaccacaagc ttcaaaaccc ttcctacaga agaagcggat      1020
     actttggtca atagtttcta taccaataag ggcgattcgt tggctctttc tctgcgaggg      1080
     ttgcctacac ttgtatccga actgacgcga actgcccatg gcaataccaa tgcagaagct      1140
     cgatctcagc aaatttatgc aactacccta tcgctagtag taaagagtct gaaagcgcac      1200
     aaagaaatgc taaacaagca aattctttct aaggaaattg ttttagattt ctcagaaact      1260
     gcagcttctt gccaaggatt ggatatcttt tccgagaatg tcgctgttca aattcactta      1320
     aatggaaccg ttagtatcca tttataa                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page