(data stored in SCRATCH zone)

EMBL: CP001887.PRFA

CP001887.PRFA        Location/Qualifiers
FT   CDS_pept        28006..29085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="G9768_00125"
FT                   /product="peptide chain release factor 1"
FT                   /note="COG0216 Protein chain release factor A"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17713"
FT                   /protein_id="ADH17713.1"
FT                   /translation="MEIKVLECLKRLEEVEKQISDPNIFSNPKEYSSLSKEHARLSEIK
FT                   NAHESLVATKKILQDDKLALSTEKDPEIVAMLEEGVLVGEEAVERLSKQLENLLIPPDP
FT                   DDDLSVIMELRAGTGGDEAALFVGDCVRMYHLYAASKGWQCEVLSTSESDLGGYKEYVM
FT                   GISGASVKRFLQYEAGTHRVQRVPETETQGRVHTSAVTVAVLPEPAEDDEEVFIDEKDL
FT                   RIDTFRSSGAGGQHVNVTDSAVRITHIPSGVVVTCQDERSQHKNKAKAMRVLKARIRDA
FT                   EVQKRAQEASAMRSAQVGSGDRSERIRTYNFPQNRVTDHRIGLTLYNLDRVMEGELDMI
FT                   TTALVTHVHRQLFGHEETA"
     atggaaataa aagttttaga gtgtttaaag cgccttgaag aagttgaaaa gcagatatcc        60
     gatccgaata tctttagtaa tcctaaagaa tatagttcgc tgagcaagga gcatgcgcgt       120
     ctttctgaga ttaaaaatgc tcatgagtca ttggttgcga caaagaaaat tcttcaggac       180
     gataaactcg ctttatcaac agagaaggat ccagaaatag tagctatgct agaagaagga       240
     gttcttgtag gggaagaggc tgtagaacgt ctatcgaagc agttagaaaa cctgcttatt       300
     ccacctgatc cagatgatga tctcagtgtg attatggagt tgcgagcagg aacgggagga       360
     gatgaagcgg ctctttttgt aggggactgt gtgcgcatgt atcaccttta tgcagcaagt       420
     aaggggtggc aatgcgaagt tctctctaca tcggagtcag atctcggagg ctacaaagaa       480
     tatgttatgg ggatttctgg ggcttctgtg aaacgtttct tgcagtatga agcaggaaca       540
     catcgtgtgc aaagggtccc agaaacagag actcagggta gggtacatac gtctgcggta       600
     acggtagctg ttcttccaga accagcagaa gatgacgaag aagttttcat tgatgagaag       660
     gatttacgta ttgatacctt ccgttcttct ggagccggag gccagcacgt caacgttaca       720
     gattccgctg tgcgtattac tcatattcct tctggcgttg tcgttacgtg ccaagatgaa       780
     cgcagtcagc ataaaaataa agctaaggct atgcgcgtgc taaaagctcg tattcgcgat       840
     gcagaagtgc agaagcgcgc gcaagaagcc tctgctatgc gttctgctca ggtaggaagc       900
     ggagatcgtt cggagcgaat tcgaacctat aattttcctc aaaaccgtgt gaccgatcac       960
     cgaattggct taactttata taacttagat cgtgtaatgg aaggagagtt ggatatgatt      1020
     acgacagctc ttgtaaccca cgtacatcgg cagctattcg gtcatgaaga aactgcttag      1080
//

If you have problems or comments...

PBIL Back to PBIL home page