(data stored in SCRATCH zone)

EMBL: CP001887.RPLM

CP001887.RPLM        Location/Qualifiers
FT   CDS_pept        141562..142014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="G9768_00645"
FT                   /product="50S ribosomal protein L13"
FT                   /note="COG0102 Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17815"
FT                   /protein_id="ADH17815.1"
FT                   /translation="MEKRKDTKTTLAKASDDRNKAWYVVNAEGKTLGRLSSEVAKILRG
FT                   KHKVTFTPHVAMGDGVIVINAEKVRLTGAKRAQKVYHYYTGFISGMREVPFENMIARKP
FT                   AYVIEHAVKGMLPKTKLGRRQMKSLRVLKGSSYAQYEAIKPIVLDA"
     atggaaaaaa gaaaagatac gaaaacgacc ctagctaagg cttcggacga tcgaaacaaa        60
     gcctggtatg tagttaatgc tgaagggaag accttaggga gattatcttc agaagttgcg       120
     aagatcctga gaggtaagca taaggtgact tttactcctc acgtagcgat gggagatggt       180
     gtcattgtga tcaatgctga gaaagtgcgt ttgactggcg caaaaagagc tcagaaagtg       240
     tatcactatt acacaggctt tatttctggg atgcgagaag ttccttttga aaacatgatt       300
     gcgcgaaagc ctgcttatgt tatcgagcat gctgttaaag gaatgttgcc taaaacaaaa       360
     cttggaagac gtcaaatgaa atctttaaga gttttgaaag gtagttctta cgcacagtat       420
     gaagctatca aaccaattgt tttagacgcg taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page