(data stored in SCRATCH zone)

EMBL: CP001887.RPLX

CP001887.RPLX        Location/Qualifiers
FT   CDS_pept        complement(591077..591412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="G9768_02715"
FT                   /product="50S ribosomal protein L24"
FT                   /note="COG0198 Ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02715"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18224"
FT                   /protein_id="ADH18224.1"
FT                   /translation="MKRRSVCVGDTVYVLAGNDKGKQGKVLRCLKDKVVVEGINVRVKN
FT                   IKRSQENPKGKRINIEAPLHISNVRLSIDNQPARLFVKVREKGRELWNKHSDGSSSLYR
FT                   SVRERKG"
     atgaagagac gtagtgtttg tgtcggtgac actgtttatg tgcttgctgg aaacgacaaa        60
     ggtaagcaag ggaaagtttt acgttgttta aaggataagg ttgtcgttga aggaatcaat       120
     gtccgagtaa aaaatattaa acgctctcaa gagaatccta aagggaagcg cattaatatt       180
     gaggctcctc tccatatttc taacgtacgt ttaagtatcg ataatcagcc tgctagactg       240
     tttgtcaaag ttagagagaa aggacgagag ctttggaata agcattccga tggaagttct       300
     tcattatacc gatcggtaag agagagaaag ggttaa                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page