(data stored in SCRATCH zone)

EMBL: CP001887.RPSC

CP001887.RPSC        Location/Qualifiers
FT   CDS_pept        complement(592723..593397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="G9768_02740"
FT                   /product="30S ribosomal protein S3"
FT                   /note="COG0092 Ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02740"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18229"
FT                   /protein_id="ADH18229.1"
FT                   /translation="MGQKGCPIGFRTAVTKKWRSLWYGNNQEFGKFLIEDVKIREFLKK
FT                   KPSCQGAAGFVVKRMSGKIEVTIHTARPGLVIGKKGAEVESLKAELKKLTGKDVWVEIA
FT                   EVKRPELNAQLVADGIAKQIERRVSFRRAMKKALQSVMDAGALGVKVQVSGRLAGAEIA
FT                   RSEWYKNGRVPLHTLRADIDYATASAETTYGIIGIKVWINLGEKKAVPAANHAGAASTA
FT                   AA"
     atgggtcaaa aaggatgtcc aatagggttc cgcacagcgg ttactaagaa atggcgatct        60
     ttgtggtatg ggaataatca agaattcgga aaatttctca ttgaagatgt gaaaattaga       120
     gaatttttga agaagaaacc ttcttgtcaa ggtgctgcgg gattcgttgt taaacgtatg       180
     agcggtaaaa ttgaagttac tatccatact gctagacctg gattagtaat cgggaagaaa       240
     ggggctgaag tagagtctct gaaagccgag ctgaaaaagc taacaggcaa agatgtttgg       300
     gttgagattg cagaagttaa acgcccagag cttaacgctc agctcgtcgc agacggtatt       360
     gccaaacaga tagaaagacg ggtttctttc agaagagcaa tgaaaaaggc tttgcaatct       420
     gtaatggatg caggtgcttt gggagtaaaa gttcaggttt ctggtcgttt agctggagct       480
     gagattgctc ggtcggaatg gtataagaac ggtcgtgtgc ctcttcatac gctcagagca       540
     gatattgatt atgctacagc gtctgcagag actacttatg gaattatcgg cataaaagtt       600
     tggattaatc ttggtgaaaa gaaggccgtt cctgcggcta atcatgcagg tgctgcttca       660
     acagctgctg cgtag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page