(data stored in SCRATCH zone)

EMBL: CP001887.TMK

CP001887.TMK         Location/Qualifiers
FT   CDS_pept        complement(210293..210904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="G9768_00970"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="COG0125 Thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17877"
FT                   /protein_id="ADH17877.1"
FT                   /translation="MFIVVEGGEGAGKTQFIQALSKRLIEEGREIVTTREPGGCSLGDS
FT                   VRGLLLDPEQKISPYAELLLFLAARAQHIQEKIIPALKSGKTVISDRFHDSTIVYQGIA
FT                   GGLGESFVTNLCYHVVGDKPFLPDITFLLDIPAREGLLRKARQKHLDKFEQKPQIFHQS
FT                   VREGFLALAEKAPDRYKVLDALLPTEASVDQALLQIRALI"
     gtgtttattg tagtagaagg cggagaaggt gctgggaaaa ctcagtttat acaagcactt        60
     tctaagcgtt taatagaaga aggcagagaa attgtcacta cgagagagcc agggggatgc       120
     tctcttggag acagtgttcg aggccttctt ctggatccag aacaaaaaat atctccatat       180
     gcagaattgt tgttgttttt agcagctcgt gcacaacaca ttcaggaaaa gatcatacct       240
     gctcttaagt ctgggaagac ggttataagc gatcgttttc acgattctac tattgtatat       300
     caaggaattg ctggaggctt aggggagagt tttgttacga acttatgtta tcatgttgtg       360
     ggagataagc cgttcttgcc agacatcaca ttcttattgg atatcccagc aagagaagga       420
     ttactacgaa aggctcgtca gaaacatctg gataaatttg agcaaaaacc acaaattttc       480
     caccagtctg tcagagaagg atttcttgct ttagcagaaa aagctccaga taggtacaag       540
     gttttagatg ccctcttgcc aacagaggct tctgttgacc aagctctctt acagattcgt       600
     gcattgatat ag                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page