(data stored in ACNUC7421 zone)

EMBL: CP001958.PE100

CP001958.PE100       Location/Qualifiers
FT   CDS_pept        complement(78775..79467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0102"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mab:MAB_2802c ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96593"
FT                   /db_xref="GOA:D6Z9R6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9R6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADG96593.1"
FT                   /translation="MIDHLVRWFGADPSWNRLGPQLGEAFGDTLWMVLVTIVFGGVLGL
FT                   ILGVVLYCSRPSGLLENRLAHIVLNVAVNVVRPIPFVLLVAALGPITLGLIHTTIGVQA
FT                   AVFVMVVSAAFAIARIVEQNLVTIDPGVIEAARAVGAGPLRIIVTLLIPEALGPLILGY
FT                   TFVLVGVVDMSAMAGVVGGGGIGDFAITYGYNRFRWDVTLVSVLIIIVFVQLAQFLGNY
FT                   LARKALRR"
     gtgatcgacc atcttgtccg ttggttcggg gcagacccga gctggaacag actcggcccg        60
     caactgggcg aagcattcgg ggacacactg tggatggtgc tcgtgaccat cgtcttcggc       120
     ggtgtcctcg gcctgatcct cggcgtcgtg ctctactgct cccggccatc cgggctgttg       180
     gagaaccggc tcgcccacat cgtgctcaac gtggccgtga acgttgtgcg gcccatcccg       240
     ttcgtgctgc tggtcgcagc gctcggcccg atcaccctcg gcctgatcca caccacgatc       300
     ggtgtgcaag cggccgtttt cgtcatggtc gtctccgccg ccttcgccat cgccaggatc       360
     gtggaacaga acctggtgac catcgacccc ggcgtcatcg aagccgcccg cgccgtgggg       420
     gcgggcccgc tgcggatcat cgtgaccctg ctcatcccgg aggcgttggg gccgctcatc       480
     ctgggctaca ccttcgtgct ggtcggcgtc gtcgacatgt cggcgatggc aggggtggtc       540
     ggcggcggcg gcattggcga tttcgccatc acctacgggt acaaccgctt ccgctgggac       600
     gtcaccttgg tgtcggtgct catcatcatc gtcttcgtgc agctcgccca attcctcggg       660
     aactatctcg cccgaaaagc tttgcgccgc tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page