(data stored in ACNUC7421 zone)

EMBL: CP001958.PE102

CP001958.PE102       Location/Qualifiers
FT   CDS_pept        complement(80519..81463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0104"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: mab:MAB_2804c ABC
FT                   transporter periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96595"
FT                   /db_xref="GOA:D6Z9R8"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9R8"
FT                   /inference="protein motif:PFAM:PF03180"
FT                   /protein_id="ADG96595.1"
FT                   /translation="MSATAPKRSANGLFPRSLAQGLVLLGTAAGSIVVVLAALVALLNF
FT                   SAKTATGGANVVVLGTTDAGKDSWSAFVAEAKQQGVEIATVNFSNYQQPNDALAQGQVG
FT                   ANLFQHLRFLAEYNVAHNTNLTPVAATFIVPLGLYSHKHKTLAEIPKGGQIAIPNDPSN
FT                   QGRALFVLRAAGLVKLVGDRLSPTTNDVDTAASKVVLVPVDPAQTARSLDSADGAVINN
FT                   NYLSDAGVDPATALAKDDPNDPSSAQYINVVVVRPEDKNNPLYSKLADIYHSRPVVDAY
FT                   NTESKGTQVPVQKSGPELQAILADIEAKTRAGQ"
     gtgagcgcga cagccccgaa gagatccgcg aacggactgt tcccaaggtc gttggcgcag        60
     gggctcgtgc tgctgggcac cgccgcgggt tcgatcgtgg tggtgctcgc agcgctcgtc       120
     gcgctcttga acttcagcgc gaaaacggcc accggcggcg cgaatgtcgt ggtcctggga       180
     accacggacg cgggcaagga cagctggtcc gccttcgtcg ccgaggcgaa gcagcagggc       240
     gtggaaatcg ccaccgtcaa cttctccaac taccagcagc ccaacgacgc gctcgcccaa       300
     gggcaggtgg gcgcgaacct tttccagcac ctgcgcttcc tcgccgaata caacgtcgcg       360
     cacaacacga acctcacccc ggtggcggcg acgttcatcg tgccgctcgg cctgtactcg       420
     cacaagcaca aaacactcgc cgagatcccc aagggcggac agatcgcaat cccgaacgac       480
     ccgtccaacc agggccgcgc tttgttcgtg ctgcgcgcgg cggggcttgt caagctcgtc       540
     ggggaccggc tgagcccgac gacgaacgac gtggacacgg cggcctcgaa agtcgtcctg       600
     gtccccgtcg accccgccca gacggcgcgc tcgctcgatt cggccgacgg ggcggtcatc       660
     aacaacaact atttgagcga cgcgggcgtg gaccccgcca cagcgctggc caaagacgac       720
     ccgaacgatc ccagctcggc gcaatacatc aacgtcgtcg tcgtgcgccc cgaagacaaa       780
     aacaatccct tgtattcgaa gctggcagac atctaccact cccggcccgt ggtggacgcg       840
     tacaacacag agtccaaagg aacgcaggtg cccgtgcaga aatccggccc ggaactccag       900
     gcgatcctgg cggacatcga ggcgaagacc agggcgggac agtga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page