(data stored in ACNUC7421 zone)

EMBL: CP001958.PE104

CP001958.PE104       Location/Qualifiers
FT   CDS_pept        82604..83548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0106"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="KEGG: npu:Npun_R6310 DNA-cytosine methyltransferase;
FT                   TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96597"
FT                   /db_xref="GOA:D6Z9S0"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9S0"
FT                   /inference="protein motif:TFAM:TIGR00675"
FT                   /protein_id="ADG96597.1"
FT                   /translation="MAPHDIVGRPRLLDLFAGCGGLSLGFESAGFEVALAVDNWPEALA
FT                   VYRRNFRHRAVELDLGDVDLASSALRECAAEVDGIIGGPPCQDFSSAGRRVEAGRADLT
FT                   EKFAQLVATFLPSFFVMENVERAAKAAAPRRAVALLEAHGYCVARIVLDASRCGVPQRR
FT                   KRLFTIGFLHPGSTRAAMGALTGNLAAAPMTLRDYFGSALDVDHYYRHPRSYARRAVFS
FT                   VDEPSPTVRGVNRPVPRGYPGHPGDTAPLTAGLRALTTAERAMVQTFPPDFWFGATKTA
FT                   AEQMIGNAVPVKLAQYVAEAVRQGLASAQRACA"
     atggctccgc acgacatcgt gggcaggccc cgactgctcg accttttcgc aggctgcggg        60
     ggattgtccc tcggcttcga gtcggcgggt ttcgaggtcg ccctcgccgt cgacaattgg       120
     cccgaagccc tcgcggtcta tcggcgcaac ttccgccacc gcgcggtcga gctcgacctc       180
     ggcgatgtgg acctcgccag ctcggccctg cgcgaatgcg cggcggaggt cgacgggatc       240
     atcggtgggc cgccctgcca ggacttttct tccgccggca gacgggtcga agcgggccgg       300
     gcggatctca cggagaaatt cgcgcaactg gtcgccacgt tcctgccgag ctttttcgtc       360
     atggagaacg tcgagcgcgc cgcgaaggcg gcggccccgc gccgggcggt ggcgcttttg       420
     gaggcgcacg gttattgcgt tgcgaggatt gtgctcgacg cgtcgcgttg cggggtgccg       480
     caaagacgca aacgtctgtt cacgattggt tttctccacc ccggcagcac ccgcgcggcg       540
     atgggggcgc tgaccgggaa cctcgcggcg gcgccgatga cgttgcgcga ttacttcggc       600
     tccgcgctgg atgtggacca ttattaccgc catccgcgca gttacgcgcg ccgggcggtg       660
     ttctcggtcg acgagccctc gccgaccgtc cggggcgtga accggccggt gcccagggga       720
     tacccgggcc atcccggcga caccgctccg ctgacggcgg ggttgcgcgc cctgaccacc       780
     gccgagcggg ccatggtgca gacattcccc ccggatttct ggttcggggc caccaagacg       840
     gctgccgagc agatgatcgg caacgcggtg ccggtgaaac tcgcgcagta cgtggccgag       900
     gcggtccgtc agggattggc ttcggcgcag cgggcatgcg catga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page