(data stored in ACNUC7421 zone)

EMBL: CP001958.PE106

CP001958.PE106       Location/Qualifiers
FT   CDS_pept        84304..86325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0108"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: nfa:nfa60 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM domain
FT                   protein; DNA gyrase subunit B domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96599"
FT                   /db_xref="GOA:D6Z9S2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9S2"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADG96599.1"
FT                   /translation="MSEKKNADKSSYGASSITILEGLEAVRKRPGMYIGSTGERGLHHL
FT                   VQEVVDNSVDEAMAGYATRVDVTLLADGGVEVVDDGRGIPVAPHASGPPTVEVVLTVLH
FT                   AGGKFDSDSYAVSGGLHGVGISVVNALSYKLEVEIDVDGFHWSQSYDKAKPGPLTKGDP
FT                   VKRTGTTVRFWADPEIFETTHYDFDTIARRLQEMAFLNKGLIITLTDLREGQIDAAEDG
FT                   EALDTAEVARSEQEAQAQAPAVKRREYHYPGGLHDYVGHINRTKTAVHNSIVSFEGKGE
FT                   GHEVEIAMQWNSGYTESVYTFANTINTHEGGTHEEGFRAALTSTMNKYARDKKILKEKD
FT                   KNLTGDDVREGLAAVISVKLGEPQFEGQTKTKLGNTEIRSFVQKICNEELTHWFEANPS
FT                   EAKLIVTKAQQAYLAREAARSARETVRRKTATDIGGLPGKLADCRSKDPSKSEVYIVEG
FT                   DSAGGSAKSGRNSEFQAILPIRGKIINVEKARIDRVLKNTEVQSIITAFGTGIHDEFDL
FT                   AKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLVEHGHVYLAAPPLYKLKWQRAEP
FT                   EYAYSDRERDALIEAGLSAGKRINKDDGVQRYKGLGEMNAKELWETTMDPDTRTLRLVT
FT                   MDDAAAADELFSILMGEDVPARRGFIARNARDVRFLDV"
     atgagcgaaa agaagaacgc cgacaagtcc tcgtacgggg caagctcgat caccatcctc        60
     gaagggctcg aagccgtccg caaacgcccc ggcatgtaca tcggctccac cggggagcgc       120
     ggcctgcacc acctcgtcca agaagtggtg gacaactccg tggacgaggc gatggccggg       180
     tacgcgacgc gcgtcgacgt caccctcctc gccgacggcg gggtcgaagt ggtggacgac       240
     ggccgaggca tccccgtcgc cccgcacgcc tccggcccgc cgaccgtcga ggtcgtcctc       300
     accgtgctgc acgcgggcgg caagttcgac tcggactcct acgccgtttc cggcggtctg       360
     cacggggtcg gcatttccgt ggtcaacgcg ctctcgtaca aactggaagt ggagatcgac       420
     gtggacggct tccattggag ccagtcctac gacaaagcca agcccgggcc tttgaccaag       480
     ggcgacccgg tcaagcggac cgggacgacc gtgcggttct gggccgaccc tgagatcttc       540
     gagaccaccc actacgactt cgacaccatc gcccggcgcc tgcaagagat ggccttcctg       600
     aacaagggcc tcatcatcac gctcaccgac ctgcgcgagg gccaaatcga cgcggcggag       660
     gacggcgagg ccctcgacac cgccgaggtg gcgcgctccg agcaggaagc gcaggcccag       720
     gccccggcgg tcaagcgccg cgaataccac taccccggcg gcctgcacga ctacgtcggg       780
     cacatcaacc gcaccaaaac ggcggtccac aactccatcg tcagcttcga aggcaagggc       840
     gagggccacg aggtcgagat cgccatgcag tggaactccg gctacaccga gtccgtctac       900
     accttcgcga acacgatcaa cacccacgag ggcggcacgc acgaagaggg cttccgcgcg       960
     gcgctcacct cgacgatgaa caaatacgcc cgcgacaaaa agatcctcaa agagaaggac      1020
     aagaacttga ccggcgacga cgtccgtgaa ggcctcgcgg cggtcatctc ggtcaagctc      1080
     ggcgagccgc agttcgaggg ccagaccaaa accaagctcg gcaacaccga gatccgctct      1140
     ttcgtgcaga agatctgcaa cgaggagctc acccactggt tcgaggcgaa cccgtccgag      1200
     gccaagctca tcgtcaccaa agcccagcag gcctacctcg cccgcgaggc cgcgcgcagc      1260
     gcccgcgaga ccgtgcgccg caagaccgcg accgatatcg gcggcctgcc cggcaagctc      1320
     gccgactgcc gttccaagga ccccagcaaa tccgaggtct acatcgtgga gggcgactcc      1380
     gcgggcggtt ccgccaagag cgggcgcaac tccgagttcc aggccatcct gccgatccgc      1440
     ggcaagatca tcaacgtcga gaaggcgcgg atcgaccggg tgctcaagaa caccgaagtg      1500
     cagtcgatca tcaccgcctt cggcaccggc atccacgacg agttcgacct cgcgaagctg      1560
     cgctaccaca agatcgtgct catggccgac gcggacgtgg acggccagca catttcgacg      1620
     ctgctgctca ctttgctgtt ccgtttcatg cggcctttgg tcgagcacgg ccacgtctac      1680
     ctcgccgccc cgccgctgta caaactcaag tggcagcgcg ccgaaccgga gtacgcctac      1740
     tccgaccggg agcgggacgc gttgatcgaa gcggggctct ccgccggcaa gcggatcaac      1800
     aaggacgacg gcgtgcagcg ctacaagggc ctcggcgaga tgaacgccaa ggagctgtgg      1860
     gagaccacca tggaccccga cacccggacc ctgcgcttgg tcaccatgga cgacgcggcc      1920
     gctgccgacg agctgttctc gatcctcatg ggcgaggatg tgcccgcccg cagaggattt      1980
     atcgcgcgca acgcgaggga tgtgaggttc ctcgatgtct ag                         2022
//

If you have problems or comments...

PBIL Back to PBIL home page