(data stored in ACNUC7421 zone)

EMBL: CP001958.PE108

CP001958.PE108       Location/Qualifiers
FT   CDS_pept        88922..89521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96601"
FT                   /db_xref="GOA:D6Z9S4"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9S4"
FT                   /inference="similar to AA sequence:KEGG:Mvan_0008"
FT                   /protein_id="ADG96601.1"
FT                   /translation="MSNPPEQEPPTTALPKVAAPARRPAERISPASDSVSAVTARLADA
FT                   RRSGADRSGSSRPAPDPAPSSAPKAAAVPSQQPSGPLRAQVQVRWIDPWTVLKVTAAVM
FT                   VVLFVAWMIGVAVLYALLEAIGVMGKINSGLGDFSTAAADQGGDIVTPGMVFGFSALVG
FT                   IVNIVLVTALATVGAFIFNLCVDLVGGVEITLADPE"
     atgagcaacc ctccggagca agagccgccg accacggcgt tgccgaaggt cgcggctcct        60
     gcccgccggc cggccgagcg catctccccc gcttcggact ctgtgtcggc ggtgactgcc       120
     cgcctcgcgg acgcgcgccg ctccggcgcg gaccgcagtg gctcctcgag acctgcccca       180
     gatcccgcgc ccagcagcgc gccgaaagcc gccgcggtcc cgtcgcagca gcccagcggc       240
     ccgttgcggg cccaagtgca ggtgcgctgg atcgacccgt ggacagtcct gaaagtcact       300
     gccgccgtga tggtcgtcct gttcgtcgca tggatgatcg gggtcgccgt cctctacgcc       360
     ttgttggagg ccatcggggt gatggggaaa atcaactcgg ggctcggcga cttctccacc       420
     gccgctgcgg accaaggcgg cgatatcgtc acccccggca tggtgttcgg cttctccgcc       480
     ctggtcggca tcgtgaacat cgtcctcgtc accgccttgg cgacggtggg cgcgttcatt       540
     ttcaacctct gcgtcgacct cgtcggtggc gtggagatca ccttggccga cccggagtag       600
//

If you have problems or comments...

PBIL Back to PBIL home page