(data stored in ACNUC7421 zone)

EMBL: CP001958.PE112

CP001958.PE112       Location/Qualifiers
FT   CDS_pept        93613..95367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0114"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="KEGG: gbr:Gbro_3920 cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; TIGRFAM: cell
FT                   envelope-related function transcriptional attenuator,
FT                   LytR/CpsA family; PFAM: cell envelope-related
FT                   transcriptional attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96605"
FT                   /db_xref="GOA:D6ZA63"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA63"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ADG96605.1"
FT                   /translation="MRIPDLSDETTRRRLAAKAARANRIRIPERAAAAERSSSSILRPL
FT                   SGKAELPPVPSKPARARWEAASRLVARAAVVLLAVSSLAATGAFWGVSRGALEGKGVLA
FT                   LLLNDPNIKDPGQQQGDENFLLIGADTREGDNGKLGAGDVNDVEGSRSDTIILVNIPAS
FT                   RARVVAVSFPRDLQVDRPACAKWNSTTKQYSKEIQPAETHSKINSAYMYGGPRCLVQVV
FT                   QKLSGLKVNHFIGEDFEGFSKMVDAVGGVQVCSTKPLYDDELGTVLAKSGSQTLDGAQA
FT                   LQYVRARQIEAEGTGDYGRIKRQQRFISSLLRSMLSQKILANPTKLNGLLEAFTDRAVM
FT                   DGVKVDDLLKLAQSMQSIQTNKVTFITIPTTGTSEDGMNNEVPNDDGVRAIFDAIIYDK
FT                   PLPGEGGSNTSSASVVTPWTVETTGKPATKTTTSSTPQPGPPPETQPAEGVKAVSVKGF
FT                   TVQVVAPTSTILYKVAMALSKQGFKVDMTSSGVAHSDTVATIARFSPESRDAAATVASA
FT                   IPGAIIELGSTPDADVELVVGSGGDVPTVVEPAAPGAGIVANEVKAVDGVVRLPENLTV
FT                   TNGADTTC"
     ttgaggattc cagacctttc tgacgagacg acccggcgtc gtctcgcggc gaaggctgcc        60
     cgcgccaacc ggatccgaat ccccgaacgg gcagccgctg cggagcggtc gtcctcttcc       120
     attctgcgcc cgctcagcgg caaggcggaa cttccgccgg tcccgagcaa gccagcccgc       180
     gcccgttggg aagccgcctc gcggctcgtc gcccgcgcgg cggtggtcct gctcgccgtg       240
     tcgagcctcg ccgccaccgg cgcgttctgg ggcgtgtccc gaggcgcgct ggagggcaag       300
     ggcgttttgg ccctcctgct gaacgatccg aacatcaaag acccaggcca acagcagggc       360
     gatgagaact tcttgctcat cggcgcggac acgcgcgaag gcgacaacgg caagctcgga       420
     gccggggacg tgaacgatgt ggagggctcc cgctcggaca ccattatcct ggtgaacatc       480
     cccgcgagcc gcgcccgcgt cgtcgcggtc tccttccccc gcgatctgca ggtcgaccgg       540
     cccgcgtgcg cgaagtggaa ctccaccacg aagcagtact ccaaagagat ccagcccgcc       600
     gagacgcact cgaagatcaa cagcgcgtac atgtacggcg ggcccaggtg cctggtccag       660
     gtggtccaga agctttcagg gctcaaggtc aaccatttca tcggcgagga cttcgagggc       720
     ttctcgaaga tggtggacgc ggtcggcggg gtgcaggtgt gctccaccaa gccgctctac       780
     gacgacgagc tcggcacggt cctggcgaag tcgggcagcc agaccctgga cggcgcgcag       840
     gctttgcaat acgtccgggc ccgccagatc gaggccgaag gcaccgggga ctacggcagg       900
     atcaagcggc aacagcgatt catctcgtcg ctcttgcgga gcatgttgag ccaaaaaatc       960
     cttgccaacc cgacgaagct caacggcctg ctcgaagcct tcaccgaccg cgcggtcatg      1020
     gacggggtga aggtggacga cctgctcaag ctggcccagt cgatgcagag catccagacc      1080
     aacaaggtca ccttcatcac gatcccgacc acgggcacct cggaagacgg gatgaacaac      1140
     gaagtgccca acgacgacgg cgtgcgtgcg atcttcgacg cgatcatcta cgacaagccg      1200
     ttgccgggcg agggcggctc gaacacctcc tccgcgtcgg tggtgactcc gtggacggtg      1260
     gagaccactg gcaaaccggc gacgaagacc acgacgagct ccaccccgca gcccggcccg      1320
     ccgccggaga cccaaccggc cgagggcgtc aaagcggtca gcgtgaaagg attcacggtg      1380
     caggtggtcg cgcccacttc gaccatcctc tacaaggtgg cgatggcgct gtccaagcaa      1440
     gggttcaagg tcgacatgac gtcgagcggg gtggctcatt ccgacacggt ggcgaccatt      1500
     gcgcgcttct cccccgagag ccgtgacgcc gccgccaccg tggcctccgc gatacccggc      1560
     gcgatcatcg aactgggctc gaccccggac gcggacgtcg agctggtggt cgggtcgggc      1620
     ggcgacgtcc cgacggtcgt cgagcccgcc gcgcccggcg cgggcattgt cgcgaacgag      1680
     gtcaaggcgg tcgacggcgt cgtgcgcctc ccggaaaacc tcacggtgac caacggggcc      1740
     gacacgacgt gctga                                                       1755
//

If you have problems or comments...

PBIL Back to PBIL home page