(data stored in ACNUC7421 zone)

EMBL: CP001958.PE113

CP001958.PE113       Location/Qualifiers
FT   CDS_pept        95474..96124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0115"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="KEGG: mgi:Mflv_1665 phosphate uptake regulator,
FT                   PhoU; TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96606"
FT                   /db_xref="GOA:D6ZA64"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA64"
FT                   /inference="protein motif:TFAM:TIGR02135"
FT                   /protein_id="ADG96606.1"
FT                   /translation="MRAVFHEQLSDLTGQLGLTCALTGEAMRQATLALLSADLVLAETA
FT                   ISKDDEISALSKDSEERAFALIAAGPTEEDLRAAVGQMQVVVDLRRMGALARHVGNVAR
FT                   RRHPLHAVPVDVHRQFEQMGEIAVALSAAARQALLTQNPVAAAKLQAEDDAMDALHQQL
FT                   FSLLLGSQWQHGVGPAVDVALLGRYYERFADHAVQIGRRVRFVATGATLSQTG"
     atgcgggcgg tatttcacga gcagctgagc gacctgactg gtcagctggg tttgacctgc        60
     gcgttgaccg gtgaggcgat gcgtcaggcc accctggcgc tgctgtccgc ggatttggtc       120
     ctcgcggaga ccgccatcag caaggacgat gagatctcgg ccctttccaa agacagcgaa       180
     gagcgggcgt tcgccctgat cgcagcaggt ccgaccgaag aggacctgcg ggcggccgtc       240
     ggccagatgc aggtcgtcgt cgatctgcgc cgcatgggcg ccctcgccag gcacgtcggc       300
     aatgtggccc gccgccgcca cccgttgcac gcggtgccgg tcgacgtgca ccgccaattc       360
     gagcagatgg gggagatcgc ggtcgccctc tcggccgccg cgcggcaggc tttgctgacg       420
     cagaacccgg tcgccgctgc gaaattgcag gccgaggacg acgcgatgga cgcgctgcac       480
     cagcagcttt tctccttgct cctcggttcg caatggcagc acggcgtcgg ccccgccgtg       540
     gacgtggcgc tcctcggcag gtattacgag cgtttcgccg accacgcggt gcagatcggc       600
     aggcgggtgc gcttcgtcgc gaccggggcg accctttcgc aaacaggctg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page