(data stored in ACNUC7421 zone)

EMBL: CP001958.PE117

CP001958.PE117       Location/Qualifiers
FT   CDS_pept        99608..100825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro05190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96610"
FT                   /db_xref="GOA:D6ZA68"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA68"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro05190"
FT                   /protein_id="ADG96610.1"
FT                   /translation="MTQPQPGKAQNLLPLALIAFGAALLAIAVLVPLYSEDELVKASLS
FT                   DRITLVSPAQSTGEDGPGLSQEFPAQVIDRCSVSSDAAKAAVLQAKATIRTYVTVEEPS
FT                   TDSTVTYQAGTSVLVSEVKSQGDGQPKTLVPTALQRSASGAPAPKTPWSDGQCDNGLLL
FT                   ATVDRVTVGRHNGLPTAKGLSEVQVEPEQQAHLLPNRSGQQYRFPFDTSSKGKYQYFDV
FT                   TTGTSFPVTYVENTEISDIKTLHFHVDVPETDLALVNMPVGYDEKEWTAPPGTTLTKPL
FT                   NWWNIPNSPGGQDQTMHRFYRNGIDLYVDPESGVIVRERQDLRQYFAEPFSAREAASPD
FT                   LRNFTLTILSGVFDYNQQTIEATVKQAKSYQDDIALYGRTIPIGSAVLGLVLLAGGGVI
FT                   YYRLTR"
     atgacgcagc cgcagcccgg aaaggctcag aaccttcttc ctttggcgct catcgctttc        60
     ggagccgcgc ttctcgccat cgcggtcctt gtcccgctct acagcgagga cgagttggtc       120
     aaagcctcgc tgtccgaccg gatcacgctg gtgtctccgg cgcagagcac cggcgaggac       180
     ggccccggcc tgagccagga gttccccgcg caggtcatcg accgctgctc ggtttccagc       240
     gacgcggcga aagcggccgt gctccaagcg aaggcgacaa tccggacgta tgtgaccgtc       300
     gaggagccgt cgacggacag cacggtcacc taccaagccg gcaccagcgt cctcgtctcc       360
     gaggtgaaat cgcaaggcga cggccagccg aagaccttgg tccccaccgc gttgcagcgt       420
     tccgcgtctg gcgctcctgc tcccaagacc ccctggtcgg acggccagtg cgacaacggg       480
     ctgctcctcg ccacggtcga cagggtgacg gtgggcaggc acaacgggct gcccaccgcg       540
     aagggcctct cggaggtgca agtggagccg gaacagcaag cccacctgtt gccgaaccgc       600
     tccggccagc aataccgatt cccgttcgac accagcagca aaggcaagta ccagtatttc       660
     gacgtgacca cgggaacctc gttcccggtg acgtacgtgg agaacaccga gatctcggac       720
     atcaagacgc tgcatttcca cgtcgacgtc ccagagacag acctcgcgct ggtgaacatg       780
     ccggtcgggt atgacgagaa ggagtggacg gctccgcctg gcaccaccct caccaagccg       840
     ctgaactggt ggaacattcc gaacagccct ggcgggcaag accagacgat gcaccgcttc       900
     taccgcaacg gcatcgacct ctacgtggac ccggagagcg gcgtcatcgt gcgcgagcgc       960
     caagacctgc gccaatactt cgccgagccg ttctcggccc gcgaagcggc cagcccggac      1020
     ctgaggaact tcacgttgac gatcttgtcc ggcgtcttcg actacaacca gcagaccatc      1080
     gaggcgacgg tcaagcaggc gaagtcctac caagacgaca tcgcgctgta cggccggacc      1140
     atccccatcg gctcggcggt gctcggcttg gtcctcctcg ctggcggcgg cgtgatttat      1200
     taccgtctca cgcggtag                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page