(data stored in ACNUC7421 zone)

EMBL: CP001958.PE119

CP001958.PE119       Location/Qualifiers
FT   CDS_pept        102630..103058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to potassium transporter Trk1p"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96612"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96612.1"
FT                   /translation="MMRHTALALPAALAGMFGFAAHAQAQPAIWSASSAHLNVSSAQYD
FT                   DPDEDDTADDADDEDEAAPDRPGGNTHFPRNGITHDDDTVAPDDDDAAPDRPGAKTHFP
FT                   RNATKLDNSGHPVTGQGPNKGTKPLNDTLDAAGGKHHC"
     atgatgagac acacggccct cgccctcccg gcggcattgg cgggcatgtt cggcttcgcc        60
     gcccacgcgc aggcccagcc tgcgatctgg tcggccagca gcgcgcacct gaacgtgagc       120
     agcgcccagt acgacgaccc agatgaggac gacacggcgg acgacgccga tgacgaggac       180
     gaggcggctc ctgaccgtcc cggcgggaac acgcacttcc cgcgcaacgg gatcacccac       240
     gacgacgaca cggttgcgcc cgacgacgac gacgcggctc ctgaccgtcc cggcgcgaag       300
     acccacttcc cgcgcaacgc gacaaagctc gacaacagcg gccacccagt cacaggccaa       360
     ggcccgaaca agggcaccaa gccgctcaac gacactttgg acgccgccgg aggcaagcac       420
     cactgctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page