(data stored in ACNUC7421 zone)

EMBL: CP001958.PE121

CP001958.PE121       Location/Qualifiers
FT   CDS_pept        108076..108924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0124"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="KEGG: hch:HCH_04117 carbonic anhydrase; PFAM:
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96614"
FT                   /db_xref="GOA:D6ZA72"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA72"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ADG96614.1"
FT                   /translation="MREIIEGFLTFQQEIYPKRLELFKKLAAAQSPKALFISCSDSRVV
FT                   LELLTQQEPGDLFVIRNAGNIVPPYGPEPGGVTATVEYAVAVLQVTDIVVMGHSNCGAM
FT                   KAIAAGQPLDSLPAVSHWLRYSDAAKAVNQAREYGSDDEKLTALVHDNVVAQISNLKTH
FT                   PTVALALAEQPLSIGQLETVVGLDSPDGELPVPLRYPVAEVLKGWFAPVSSDAGAPDSV
FT                   VFVDSSARPKLLAHLAAGGRLVGFGLDLDGGRAAAAQGRRGRSRAVRPGGGFGLMLAPP
FT                   K"
     gtgcgcgaga tcattgaggg atttctgact ttccagcagg agatttatcc gaaacggctg        60
     gagctgttca aaaagctcgc cgccgcgcag agcccgaagg cgctcttcat cagctgctcg       120
     gacagccgcg tcgtgttgga gttgttgacg cagcaggagc cgggagacct gttcgtcatc       180
     cgcaacgcgg ggaacatcgt cccgccctac ggccccgagc ctggcggcgt cacggcgacc       240
     gtcgaatacg ctgtcgccgt gctgcaggtg acggacatcg tcgtgatggg gcactccaac       300
     tgcggcgcga tgaaggccat cgccgccggg cagcccctgg actcgctgcc cgcggtcagc       360
     cactggctgc ggtattcgga cgcggcgaaa gccgtcaacc aggcgcgcga gtacgggtcg       420
     gacgacgaga agctgaccgc gttggtccac gacaacgtcg tcgcccagat ctcgaacctg       480
     aaaacacacc ccacggtcgc cctcgcgctg gcggaacaac cgttgtccat cgggcaattg       540
     gagacggtgg tgggcttgga ttccccggac ggcgagttgc ctgtgccgtt gcgctacccg       600
     gtcgcagagg tgctcaaggg ctggttcgcc ccggtctcgt ctgatgctgg cgcgccggat       660
     tcggtggtgt tcgtcgattc ctcggctcgt ccgaagctgc tcgcgcatct tgctgctggt       720
     ggacgactgg tcggattcgg gttggacctt gacggtggcc gcgcggctgc tgcgcaaggc       780
     aggcgcggac gaagtcgcgc cgttcgtcct ggcggtgggt tcggtttgat gcttgcgccc       840
     cccaaataa                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page