(data stored in ACNUC7421 zone)

EMBL: CP001958.PE124

CP001958.PE124       Location/Qualifiers
FT   CDS_pept        complement(111975..113081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0127"
FT                   /product="mycothiol-dependent formaldehyde dehydrogenase"
FT                   /note="KEGG: nfa:nfa12230 putative dehydrogenase; TIGRFAM:
FT                   mycothiol-dependent formaldehyde dehydrogenase; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96617"
FT                   /db_xref="GOA:D6ZA75"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR017816"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA75"
FT                   /inference="protein motif:TFAM:TIGR03451"
FT                   /protein_id="ADG96617.1"
FT                   /translation="MPQTVKGVVSRAKGAPVELVDVVVPDPGPAEVVVQIQACGVCHTD
FT                   LAYRDGNITDQWPFLLGHEAAGTVEAVGSAVTHVEPGDFVVLNWRAVCGECRACRKGKQ
FT                   QYCCNTFNAEQPMTLTDGTALTPALGIGAFIEKTLVHQGQCTKVNPAADPAVAGLLGCG
FT                   VMAGIGAAVHTGAVARGDAVAVIGCGGVGSAAVAGARLAGASVVIGVDVDQRKLDWAKD
FT                   LGATHTILSGEGVHVPEAVKALTGGFGADVVIDAVGRPETWEQAFYARDLAGVVVLVGV
FT                   PSPTMRLEMPLLDFFSHGGSLKSAWYGDCLPERDFPALVDLSLQGRLPLEKFVTERIGV
FT                   GDVEEAFHAIHEGRVLRSVVVFGANNPG"
     ttgccgcaaa ccgtcaaagg tgtcgtctcc cgcgccaaag gcgctcccgt cgaactcgtc        60
     gacgtggtgg tccccgaccc cggccccgcc gaagtcgtcg tgcagatcca agcctgcggg       120
     gtctgccaca ccgacttggc ctaccgggac gggaacatca ccgaccaatg gccgttcctg       180
     ttgggccacg aggccgcggg gaccgtggag gcggtgggct ccgcggtcac ccatgtggag       240
     cccggcgact tcgtcgtgct caactggcgg gcggtctgtg gggaatgccg cgcctgccgc       300
     aagggcaaac agcagtactg ctgcaacacc ttcaacgccg agcaacccat gacgttgacc       360
     gacggcacag cgctgacccc ggcgctcggc atcggcgctt tcatcgaaaa aaccctcgtc       420
     catcaagggc aatgcacgaa agtgaacccc gcggcagacc ctgcggtcgc gggcctgctc       480
     ggttgtggcg tgatggcggg gatcggggcc gccgtgcaca ccggcgcggt cgcgcgcggc       540
     gatgccgtgg cggtgatcgg ctgcggcggc gtcggatcgg cagcagtcgc cggggctcgg       600
     ctcgcgggag cctcggtggt catcggcgtc gatgtggacc agcgcaagct cgactgggcc       660
     aaagacctcg gcgcgacgca cacgatcctc tccggcgagg gcgtccatgt gcccgaggcg       720
     gtcaaagcgc tcaccggcgg cttcggcgcg gatgtggtga ttgacgcggt gggccgccca       780
     gaaacctggg aacaggcgtt ttacgcccgc gacctcgcgg gggtcgtggt cttggtcggc       840
     gtgccctccc cgacgatgcg cctggaaatg ccgctgctgg acttcttctc ccacggcggc       900
     tcgctcaaat cggcctggta cggcgactgc ctcccagaac gggacttccc cgcgctcgtg       960
     gacttgagcc tgcaaggcag gctgcccttg gagaaattcg tcaccgagcg gatcggcgtg      1020
     ggcgacgtgg aagaagcctt ccacgccatc cacgaagggc gagtgctgcg ctcggtcgtc      1080
     gtgttcggcg cgaacaaccc cggttag                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page