(data stored in ACNUC7421 zone)

EMBL: CP001958.PE129

CP001958.PE129       Location/Qualifiers
FT   CDS_pept        complement(118796..120970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0133"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: mab:MAB_4224 serine/threonine-protein kinase;
FT                   PFAM: Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; Tyrosine- protein kinase,
FT                   subgroup, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96622"
FT                   /db_xref="GOA:D6ZA80"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR031634"
FT                   /db_xref="InterPro:IPR031636"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA80"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG96622.1"
FT                   /translation="MTEAFSPADTTQPAPTAPVESSGPAKRAERTVTVPLSERLIGGGL
FT                   VRIQPAPALDPSLALMPDPQVPENKRFCWKCHAPVGRKGPDDPGLPEGVCGNCGTPFSF
FT                   LPQLKAGEVVAGQYVVRGPIAHGGLGWIYLAEDRNVDNRPVVLKGLLSRGDASAQAIAR
FT                   AERQFLSEVSHPAIVEILNFVEHPDLDGVPVGYIVMQYIGGVSLRDLLYGRKPGSPPLG
FT                   GALRRTSLPVEQALAYLMEIMPALGYLHSIGLAYNDLKPENIMLTEGQLTLIDLGAVTS
FT                   MHDTNRLYGTVGYQAPELTLTGPTVQTDVFTVGRTLAVLTVDLPLDKGRYAEGLPSPQE
FT                   EPVFAKYPSYYQLLLRATHPNSRARFQSASEMSVQMSGVLREVLAERRGRPYPSSSTLF
FT                   TASRGEFGTDVLSRRLDVYADGRDRRGELRRDEVVQALPLPLVDPAHPSAALLATLLHT
FT                   KPEHALESVTGALESDPDDTETVLAAVRVHMGLGQLDEAARLLDNLYAPRNWRPSWYQG
FT                   NLALLQGDLEEAKKSFEEVWGMLPGEPAPKLALAVVLELLDDPAAKTLYRLCSTTDDGL
FT                   ISATFGLARRLSAEGDPMGAVAALDKVPSSSRHAATATVSAIVILLKDEVDEDLLRAAA
FT                   ERQQRLPKEEPRTLAARALLLGKAVDWMQGRPAHSPPLSGSFLGKPFTLHSLRRQSEFV
FT                   LRALAKRAAHRSQRYALVDLANIVRPRTVF"
     atgacggagg cgttctcccc cgccgacacc acccagccgg cccccaccgc gccggtggag        60
     agcagcggcc ccgccaaacg cgccgaacgc accgtcaccg tgccgttgtc cgagcggctg       120
     atcggcggcg gcctggtgcg aatccaaccc gctcccgcgt tggacccctc cctcgccctg       180
     atgccggacc cccaggtgcc ggagaacaag cggttctgct ggaaatgcca cgcgccggtg       240
     ggccgcaagg gcccggacga cccagggctg cccgaagggg tctgcggcaa ttgcggcacc       300
     ccgttctcgt tcctgcccca gttgaaagcc ggggaagtcg tcgcgggcca gtacgtggtc       360
     cggggcccga tcgcgcacgg cggcctcggc tggatctacc tcgcggagga ccgcaacgtc       420
     gacaaccggc ccgtggtgct caaaggcttg ctctcccgag gggacgcgag cgcccaggcc       480
     atcgcgcggg ccgaacgcca attcctctca gaagtctccc atccggccat cgtggagatc       540
     ttgaacttcg tggagcaccc ggaccttgac ggcgtgccgg tcggctacat cgtcatgcag       600
     tacatcggcg gggtgtccct gcgcgacctg ctctatggcc gcaaacccgg ctccccgccg       660
     ctcggggggg cccttcgccg caccagcctg cccgtggaac aggcgctcgc gtacctcatg       720
     gagatcatgc ccgctctggg gtatttgcac tccatcggcc tggcctacaa cgacttgaag       780
     ccagagaaca tcatgctcac cgaggggcag ctcacgctca tcgacctggg cgcggtgacg       840
     agcatgcacg acaccaaccg cctgtacggg acggtcggct accaagcgcc ggaactgacc       900
     ctcaccgggc cgaccgtgca gaccgacgtg ttcacggtcg ggcgcacgtt ggcggtgctg       960
     accgtggacc ttccgctgga caagggccgc tacgcggagg ggctcccctc cccgcaggag      1020
     gagccggttt tcgccaagta cccctcctac taccagcttc tgctgcgcgc gacgcacccg      1080
     aactccagag cccggttcca gtccgccagc gagatgtcgg tgcagatgtc cggggtgctg      1140
     cgcgaagtgc tcgccgaacg caggggcagg ccgtacccgt cgagttcgac cctgttcacc      1200
     gcgagccggg gcgagttcgg caccgacgtg ttgtcgcgca ggctggacgt ctacgccgac      1260
     ggacgggacc gccggggaga gctgcgccgg gacgaggtcg tccaggcgct gccgctgccg      1320
     ctggtcgatc ccgcccaccc gtctgcagcg ctgctggcga ccttgctgca caccaagccg      1380
     gagcacgcgt tggagtcggt gaccggcgcc ttggagtccg accccgacga caccgagaca      1440
     gtcctcgccg ccgtccgcgt gcacatgggc ctcggccagc tcgacgaggc ggcccgtctt      1500
     ctggacaacc tgtacgcccc gcgcaactgg cgcccgtcct ggtaccaggg gaatctggcc      1560
     ctgctccaag gcgacctcga agaggccaag aagtcgttcg aagaggtctg ggggatgctg      1620
     cccggcgagc ccgcgccgaa actcgccctc gctgtcgtgt tggagctcct ggacgatccg      1680
     gccgcgaaga ccctgtaccg cttgtgttcg accacggacg acgggctcat cagcgccacg      1740
     ttcggcctcg cgaggcggct ctcagcggag ggcgacccga tgggcgcggt cgcggcgctg      1800
     gacaaagtgc cttcgagttc acgccacgcc gccacggcga cggtgagcgc gatcgtcatc      1860
     ctcctcaagg acgaggtgga cgaggatctg ctccgcgcgg cggccgagcg gcagcagcgc      1920
     ctcccgaagg aggagccgcg cacactcgcc gcgcgcgcgc tcctgctcgg caaggcggtc      1980
     gactggatgc agggcaggcc cgcgcactcg cccccgctca gcggcagctt cctcggcaaa      2040
     cctttcacct tgcactcgct gcgccgtcaa agcgagttcg tgctccgcgc gctcgcgaaa      2100
     cgggccgctc accgcagcca gcgttacgcg ctggtggatc ttgcgaacat cgttcgcccg      2160
     cgcactgttt tctga                                                       2175
//

If you have problems or comments...

PBIL Back to PBIL home page