(data stored in ACNUC7421 zone)

EMBL: CP001958.PE13

CP001958.PE13        Location/Qualifiers
FT   CDS_pept        15537..16361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_34660 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96506"
FT                   /db_xref="GOA:D6Z9H9"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9H9"
FT                   /inference="similar to AA sequence:KEGG:ROP_34660"
FT                   /protein_id="ADG96506.1"
FT                   /translation="MATSDQPGNTPGDDRAGKAGFSEDHGPELSVETLALLHADALEGA
FT                   ERDRAKAQAAADPAAQAVLAGLDMVCAQLRRLDHAAPPAEQMPEFLARRMDRELAKLSE
FT                   TPEARRRRWTAAASVGSVAAAAAVLSLVTYAAWPRQEQDSPQPQAQPEPSAAQETSAEA
FT                   TEPLLASVDNRFTIERKDFSTLLRSGGSFKDLGPLSDEAIRGDCLAANGFPADQQLVAA
FT                   GRIKRGDKEGIFMMIPTPAMRGGAPGMTVLVVGSECRAGIPATLSKQVLSRN"
     atggcgacga gcgatcagcc gggaaacacc cccggcgatg accgcgcggg gaaggccggg        60
     ttctccgagg accatggtcc tgagctgtct gtggagacat tggctctgct gcacgccgac       120
     gccttggaag gcgccgagcg cgaccgggcg aaggcacaag cggccgccga ccccgccgcc       180
     caggcggtgc tcgccgggct cgacatggtc tgcgcccagt tgcgccgatt ggaccacgcc       240
     gcaccccccg ctgagcagat gccggagttc ctcgcgcgcc gcatggaccg cgagctcgcg       300
     aaattgagcg agacgccgga ggctcgccgc cgccggtgga cggccgcggc gagtgtcggc       360
     tctgtcgcgg cggcggccgc ggtgctctcg ttggtcacct atgccgcgtg gcccaggcag       420
     gagcaggact ccccgcagcc ccaggcgcag ccggagccgt ccgccgcgca ggagacgagc       480
     gctgaggcga ccgagccgct cttggcgtcc gtcgacaacc ggttcacgat cgaacgcaag       540
     gacttcagca cgctgctgcg ctcgggcggc tccttcaagg acctcggccc gctttcggac       600
     gaagcgatcc ggggcgactg cctcgccgcg aacggcttcc cggcggacca gcagctcgtg       660
     gcggcgggcc ggatcaagcg aggcgacaaa gaaggcatct tcatgatgat cccgacgccc       720
     gccatgcgcg gcggggctcc ggggatgacc gtcctcgtcg tcggctccga gtgccgagcc       780
     gggattccgg cgaccttgtc gaagcaagtc ctcagccgga actaa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page