(data stored in ACNUC7421 zone)

EMBL: CP001958.PE131

CP001958.PE131       Location/Qualifiers
FT   CDS_pept        complement(122090..123427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro02193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96624"
FT                   /db_xref="GOA:D6ZA82"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA82"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro02193"
FT                   /protein_id="ADG96624.1"
FT                   /translation="MRTISPLSVLKTDAASLRRGRRTTADEDTDFLELLWERAQTSPGK
FT                   LAATALGLILLIIIAGATVAQAVAERTQGLDTTLRRAEPLTNVTLTLYTELSIADAITG
FT                   AVFLSPGLESQEMRDRYDKAIAAASAATVQVAANTQSQQLETIAEELPVYTKLVESAKV
FT                   YNRAGKPVGAAYLSQASHLMQTVILPAAEHMHRDQIDALEAAQQQQTQLPWAPALLLTL
FT                   ALGSLVLAQLHLSKRSRRRFNPGLILASGCFALLLLWFLVASAFLVTLSGEGQRKGTDP
FT                   LRTLTAARIDVQQARTQETLQLLRRGDEDQLEQSYRSSMAAAHNQLDELDRAQGEPGAR
FT                   QTAASAAQAWEKTHEQLRKDLVAGMYGESVELAIGPSPDACAAQYRSLDKALTSDIEHS
FT                   RRTLRDSVASAREALTALAPATAVLSFLAAAFVVAGYWPRLNEYRA"
     gtgcgaacca tatctcccct ctccgtgctg aaaaccgacg ccgcgtcgtt gcggcgcggt        60
     cgcaggacga cggccgacga ggacacagac ttcctggaac tgctctggga gcgggcccag       120
     accagccctg gcaaactcgc cgccaccgcg ctcggcttga tcctgctcat catcatcgcc       180
     ggagccactg tggcgcaggc cgtcgccgaa cgcacacaag gtctggacac gacgctgcgg       240
     cgcgcggaac cgctcaccaa cgtcacactg accttgtaca ccgagctgtc catcgcggac       300
     gccatcaccg gggctgtctt cctgtccccc ggactggagt cgcaagagat gcgcgaccgg       360
     tacgacaagg ccatcgcggc ggcgagcgcg gcgaccgtgc aagtcgcggc gaacacccaa       420
     agccagcaac tggagaccat cgccgaagag ctcccggtgt acacgaagct cgtggagagc       480
     gcgaaggtgt acaaccgggc gggcaaaccg gtcggggccg cctacctgag ccaagcctcc       540
     cacctgatgc agacggtcat cctgcccgcc gcagagcata tgcaccgcga ccagatcgac       600
     gccttggagg ccgcgcagca gcaacaaacc cagctgccct gggccccggc gctgctgttg       660
     accctggcct tgggcagcct cgtcctggcg caattgcacc tttcgaaacg ttcgcgtcgg       720
     cgtttcaacc ccggcctgat cctcgccagc ggatgcttcg cgctgctgtt gctctggttc       780
     ctcgtcgcct cggcgttcct ggtgacgctc agcggcgaag ggcagcgcaa aggcaccgac       840
     ccgctgcgga ccctgacagc ggccaggatc gacgtgcaac aagcccgcac ccaggagacc       900
     ctgcagctgc tccgccgggg cgacgaggac cagctggagc agagctaccg ctccagcatg       960
     gccgccgcgc acaaccagct cgacgaattg gaccgcgcgc aaggcgagcc gggggcccgg      1020
     cagaccgccg cctcggcggc gcaagcttgg gagaaaaccc acgagcagct gcgcaaagac      1080
     ctcgtcgccg ggatgtacgg tgaatccgtg gaattggcaa tcggaccaag ccccgacgcg      1140
     tgcgccgccc agtaccgttc cctggacaaa gccctcacct cggacatcga gcattcgcgg      1200
     cggacgctgc gcgactctgt cgccagcgcg cgcgaggcgc tcaccgcgct ggcgcccgcc      1260
     accgccgtcc tctcgttcct cgcggcggct ttcgtcgtcg cgggatactg gccgagactg      1320
     aacgagtacc gggcatga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page