(data stored in ACNUC7421 zone)

EMBL: CP001958.PE134

CP001958.PE134       Location/Qualifiers
FT   CDS_pept        125699..127585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0138"
FT                   /product="Cytochrome c oxidase caa3-type, assembly factor
FT                   CtaG-related protein"
FT                   /note="PFAM: Cytochrome c oxidase caa3-type, assembly
FT                   factor CtaG-related; KEGG: mul:MUL_4847 integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96627"
FT                   /db_xref="GOA:D6ZA85"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA85"
FT                   /inference="protein motif:PFAM:PF09678"
FT                   /protein_id="ADG96627.1"
FT                   /translation="MSFLFLIGLVAAVAFAARVGPGPYLAVQVPYPGTEVLLVQVATQF
FT                   VASFAGAVCLGGLVFALCCTRPNAKMRLGPRGYAGLRTAERASPLWAVSALFAMVTSAT
FT                   VQAGRAPWDLLHVEDPVGRLVSLVSVSERSGAWLVVAVLATAVAALSRCCLGWASCAGL
FT                   AWLSVFAVVAPWMTQNAGDGPNHDWASGAAVWTSVGLAVLVGVGAQMRGDWTQDRAAAQ
FT                   RRARRTSAVALGMVAAGSAVLGALLIPLSAMPSTWYGQLGLAAAVLFALAAAAVFFGKL
FT                   TVAAGAGVVLLAVAEAMSVQPAPAFAGQRFSVPELLLGFDFPGAPTLWRLLSAWRFDVV
FT                   FGTLAVLLAAAYVLGAARLRGRGDAWSPWRTLSFLFGCALLLLVTSSGIGRYASGQFSY
FT                   HMISHMGLNMFAPVFLVLGAPVTLLLRAAPTAGQHMAGPREWALALVHARLVQILAHPL
FT                   VAVGLFVVSLYGLYFTPVFGLLVRYHWGHLLMTLHFLAIGYTYYWAIIGVDPGARRLPH
FT                   LARLGMLFAVMPFHAFFGVAVLSDNEIIGGDFYRWLALPWVSDLASDQRVAGAVAWTSG
FT                   EIPIVFVVGALLYQWAGADRRAASRADRHAADYEDAELDAYNHMLQKLVERG"
     atgtcgttcc ttttcctgat cggactcgtc gcggcggtgg cgttcgccgc ccgcgtcggc        60
     cctggcccct acctggcggt ccaagtgccc taccctggca cagaggtcct cctcgtgcag       120
     gtcgcgacgc agttcgtcgc gagcttcgcc ggagccgtgt gccttggcgg cctcgtgttc       180
     gcattgtgct gcacccgccc gaacgccaag atgcgcttgg gcccgcgcgg ttacgcgggg       240
     ttgcgcacgg cagaacgggc gagcccgctg tgggcggtga gcgccctgtt cgcgatggtg       300
     acgagcgcga cggtccaggc cgggcgcgcg ccatgggatc tgctccacgt cgaagaccct       360
     gtcggcaggc tggtctcgct cgtgtcggtc tccgagcgct ccggggcgtg gctggtcgtg       420
     gccgtgctcg cgacagcggt ggccgccctt tcgcgatgct gcctgggatg ggcctcgtgc       480
     gcggggctgg cctggctttc cgtgttcgcc gtcgtcgccc cgtggatgac gcagaacgct       540
     ggcgacgggc ccaaccatga ctgggcgagc ggcgcggcgg tgtggacgag cgtcggtttg       600
     gcggtgctgg tcggggtcgg agcgcaaatg cgcggtgact ggacgcagga ccgcgcggcg       660
     gcccagcggc gggcacggcg gaccagcgct gtcgcgctcg gcatggtcgc ggcgggctcc       720
     gcggtgctcg gcgcgctgtt gatcccgctt tcggccatgc cgagcacctg gtacgggcag       780
     ctcggcctcg ccgccgccgt gctgttcgcg ctcgccgccg ccgcggtctt cttcggcaag       840
     ctgaccgttg ccgccggggc cggggtcgtg ctgctcgctg tcgccgaggc gatgtccgtc       900
     cagcccgccc cggcgttcgc ggggcaaaga ttctccgttc ccgaactgct gctcgggttc       960
     gatttccccg gggccccgac gctgtggcga ctgctgtcgg cgtggcggtt cgacgttgtt      1020
     ttcggcaccc ttgccgtgct cctcgcggcg gcgtacgtgc tcggcgcggc gcgattgcgc      1080
     gggcgcggcg acgcgtggtc gccgtggcgg acgctttcct tcctcttcgg ctgcgctttg      1140
     ctgctgctcg tgacctcctc agggatcggc cgttacgcgt cgggccagtt cagctaccac      1200
     atgatctccc acatggggct caacatgttc gccccggtct tcttggtgct cggggctccg      1260
     gtgacgttgc tgctgcgcgc ggcgcccacg gccgggcagc acatggccgg gccgcgagaa      1320
     tgggcgctcg cgctcgtgca cgcgcgtctt gtgcagatcc tcgcgcatcc gctggtcgcg      1380
     gtcgggctct tcgtggtttc cctctacggg ctgtacttca ccccggtgtt cgggctgctc      1440
     gtccggtacc actgggggca cctgctgatg accctgcatt tcctcgccat cgggtacacg      1500
     tattactggg cgatcatcgg ggtcgacccc ggcgctcgtc ggctgccgca cctggcgcgg      1560
     ctggggatgc tcttcgcggt catgccgttc cacgcgttct tcggggtggc cgtgttgtcc      1620
     gacaacgaga tcatcggggg ggatttctac cggtggctcg cgctgccgtg ggtgagcgat      1680
     cttgcctcgg atcagcgcgt cgcgggcgcg gtggcgtgga ccagcggcga aattcccatc      1740
     gtgttcgtcg tcggcgcgct gctctaccaa tgggcgggcg cggaccggcg cgcggcgagc      1800
     cgcgccgacc ggcatgccgc ggattacgag gacgcggagc tggacgccta caaccatatg      1860
     ctgcagaaac tggtcgaacg gggctga                                          1887
//

If you have problems or comments...

PBIL Back to PBIL home page