(data stored in ACNUC7421 zone)

EMBL: CP001958.PE136

CP001958.PE136       Location/Qualifiers
FT   CDS_pept        complement(128222..129313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0140"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   rha:RHA1_ro00808 2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96629"
FT                   /db_xref="GOA:D6ZA87"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA87"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ADG96629.1"
FT                   /translation="MPLELEQSRSILPGLAIPIICAPMAGGPSTPQLAAAASNAGGLGF
FT                   LGAGYLDPAATAALLDATRELTVHPFGVNIFVPSSDPVDHAAVAAYRERLLPAAEAAGV
FT                   ALPEAGSADPAHPDDDFYDEKIDLAIDREVPLVSFTFGLPSAQVVAKLHDAGIAVVASV
FT                   ASVSAVSSADALGVDAIVVQGPEAGGHRATLSNHEKPEHVPLADLLLWAAEATTAPLIA
FT                   AGGVSRGSHIAELLASGASAVQLGTAFLRAEEAGTRPAHRAALTDPRFVETSVTNAFSG
FT                   RPARGLRNAFMDAHSSHAPGEYPQVHWLTSPLRAAAAKRGDAESISLWAGVGYPETKSG
FT                   PAAAILSALWEDALAARAEHGGS"
     atgccgcttg agcttgagca aagccggagc atcctgcccg gcctcgcgat cccgatcatc        60
     tgcgcgccga tggcgggcgg cccgagcacg ccgcaactgg ccgccgccgc gagcaatgcg       120
     ggcgggctgg gcttcctggg cgccgggtac ctcgacccgg ccgcgacagc ggcgctgctg       180
     gacgcgacgc gagagctcac cgtccaccct ttcggggtca atattttcgt tcccagctcg       240
     gacccggtgg accatgccgc tgtggccgcc taccgcgaac gcctgctgcc cgccgccgaa       300
     gcggcgggcg tggccctgcc ggaggctggc tcggcggacc cggcgcaccc cgatgacgac       360
     ttttacgacg agaaaataga cctcgcgatc gaccgggagg tcccgctggt ctccttcact       420
     ttcggcctcc cgtccgcgca ggtcgtggca aaactgcacg acgcggggat cgcagtggtc       480
     gcgagcgtcg cctctgtttc ggcggtgagc tccgccgacg cgctgggcgt ggacgcgatc       540
     gtcgtgcaag gccccgaggc cggggggcac cgcgcgacgc tctccaacca tgagaaaccg       600
     gagcatgtgc ccctcgccga cctgctgctc tgggcggccg aggccacaac tgcgccgctc       660
     atcgccgcgg gcggcgtcag ccgtggttcg cacatcgccg aactgctggc gtcaggggcg       720
     agcgccgtgc agctggggac cgcttttttg cgcgccgagg aagcaggcac ccggcccgcg       780
     caccgggcgg cgctgaccga tccacggttc gtggagacat ccgtgaccaa cgcgttttcc       840
     gggcgccctg cgcggggcct gcgcaacgcg ttcatggacg cgcattcctc gcacgcccct       900
     ggggagtacc cgcaggtgca ttggctcacc tcgccgttgc gcgcggcggc ggcgaaacgc       960
     ggcgacgcgg agtcgatcag cctctgggcc ggagtcggct accctgagac caaatccggc      1020
     cctgccgcgg cgatcctctc ggccctctgg gaggatgcgc tcgccgctcg cgcggagcac      1080
     ggggggtcgt ag                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page