(data stored in ACNUC7421 zone)

EMBL: CP001958.PE141

CP001958.PE141       Location/Qualifiers
FT   CDS_pept        complement(133559..134989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0145"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="TIGRFAM: adenylosuccinate lyase; KEGG: rop:ROP_48780
FT                   adenylosuccinate lyase; PFAM: Adenylosuccinate lyase-like;
FT                   fumarate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96634"
FT                   /db_xref="GOA:D6ZA92"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA92"
FT                   /inference="protein motif:TFAM:TIGR00928"
FT                   /protein_id="ADG96634.1"
FT                   /translation="MSTPQTPDVLAARYATKELVALWSPRARVVLERDLWIAVLKAQIE
FT                   LGVPGGDAASVADYERVKEQVDLDSIAARERVTRHDVKARIDEFNALAGHELVHRGMTS
FT                   RDATENVEQSVIRASLAHVRDHAVAALARLAERAAQYAPTMLVARSHNVPAQATTLGKR
FT                   FATCAQELLIAVRRVDELIERYPLRGIQGPVGTAQDMLDLLGGDRDKFARLQRSVAEHV
FT                   GFTQALVSVGQIYPRSLDHDVVSALVQLAAAPSSFAHTLRLMAGQELATEGFQPGQVGS
FT                   SAMPHKTNPRTSERINGLAVVLRGYASMTAELAGAQWNEGDVFCSVVRRVALPDAFYAI
FT                   DGLFEGFLTVLGEFHAFEPVIEREVARYLPFLGTTRILMAAVRAGVGREAAHEAIKEHA
FT                   VALANDIRERGAEPDLLSRLAQDQRLGLTRAQLDEALADRDLFLGAADDQVRRVIDEVE
FT                   ALVAKHPEAAAYRPGSIL"
     atgagcactc cgcagacgcc tgacgtcctc gctgcccgct acgcgacgaa agagcttgtg        60
     gcgctctggt cgccccgcgc ccgcgtcgtc cttgagcgcg atctttggat cgccgtgctc       120
     aaggcgcaga tcgaactggg cgtccccggc ggggacgcgg ccagcgtcgc cgactacgag       180
     cgggtcaagg aacaggtcga cctggactcc atcgcagcgc gggaacgagt cacccgccac       240
     gacgtgaagg cgcggatcga cgagttcaac gccctcgccg ggcacgagct ggtgcacagg       300
     ggcatgacca gccgagacgc caccgagaac gtggagcaat ccgtcatccg cgcctcgctg       360
     gcccacgtcc gagaccacgc ggtcgccgcg ctggcccggc tcgccgaacg cgcggcccaa       420
     tacgcgccga ccatgctggt ggcccgcagc cacaacgtcc ccgcgcaagc gaccacgctc       480
     ggcaagcgtt tcgccacctg cgcccaggaa ctgctcatcg cggtgcgccg ggtggacgag       540
     ctgatcgagc gctatccgct gcgcggcatc cagggcccgg tcggcaccgc gcaggacatg       600
     ctcgaccttc tcggcgggga ccgcgacaaa ttcgcccggc tccaacgcag cgtcgccgag       660
     cacgtcggct tcacccaagc cctggtcagc gtcgggcaga tctatccgcg ctccctcgac       720
     cacgacgtcg tctccgcgct ggtgcagctc gccgccgcgc cctcctcgtt cgcgcacacc       780
     ctgcgcctga tggcgggcca agagctcgcc accgaagggt tccagcccgg acaggtcggc       840
     tcctccgcga tgccgcacaa gaccaatccg cgcaccagcg agcgcatcaa cggactcgcc       900
     gtcgtcctgc gcggctacgc ctcgatgacc gccgagctcg ccggagcgca gtggaacgag       960
     ggcgacgtgt tctgctccgt tgtgcgacgg gtggccctgc ctgacgcgtt ctatgcgatc      1020
     gacggccttt tcgagggctt tttgacggtg ctcggcgagt tccacgcctt cgagccggtg      1080
     atcgagcgcg aagtcgcccg ctacttgcct ttcctcggca ccacccgcat cctcatggcc      1140
     gcggtgcggg cgggagtggg ccgggaagcc gcgcacgagg cgatcaaaga gcacgcggtg      1200
     gcgctggcca acgacatccg cgagcgcgga gccgagccgg acctgctctc gcggctcgcc      1260
     caggaccaac gactgggatt gacccgagcg cagctggacg aggcgctcgc cgaccgcgac      1320
     ctgttcctcg gcgcggccga cgaccaggtc cgtcgcgtca tcgacgaggt ggaggccctg      1380
     gtcgcgaagc acccggaagc ggccgcctac cggccagggt cgattttgtg a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page