(data stored in ACNUC7421 zone)

EMBL: CP001958.PE145

CP001958.PE145       Location/Qualifiers
FT   CDS_pept        137562..138227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0149"
FT                   /product="50S ribosomal protein L3"
FT                   /note="KEGG: nfa:nfa7330 50S ribosomal protein L3; TIGRFAM:
FT                   50S ribosomal protein L3; PFAM: ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96638"
FT                   /db_xref="GOA:D6ZA96"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA96"
FT                   /inference="protein motif:TFAM:TIGR03625"
FT                   /protein_id="ADG96638.1"
FT                   /translation="MTSSTSKNRVGLLGAKLGMTQVFDERNRVVPVTVIRTGVNVVTQV
FT                   RTPERDKYSAIQLAFGHIDPRKVNKPLAGQFEKAGVTPRRHLAEFRLDDVSGYEVGQQI
FT                   DATVFSAGDLVDVTGTSKGKGFAGTMKRHGFKGQGASHGAHKVHRRPGSIGACAFPGRV
FT                   FKGTRMAGRMGNAKTTTQNLTVFRVDPEAGVLLIKGAVPGRDGGLVFIRSAVKKGVAK"
     atgacttctt ccacttccaa gaaccgcgtg ggcctgttgg gcgcgaagct cggcatgacc        60
     caggtcttcg acgagcgcaa ccgcgtcgtc ccggtgaccg tgatccgcac cggcgtcaac       120
     gtcgtcaccc aggtccgcac ccccgagcgc gacaagtact cggccattca gctggccttc       180
     ggccacatcg acccccgcaa ggtgaacaag ccgctggccg gccagttcga gaaggccggg       240
     gtcaccccgc gccgccacct cgcggagttc cgcctcgacg acgtctccgg ctacgaggtc       300
     ggccagcaga tcgacgcgac cgtgttctcg gccggcgact tggtcgatgt gaccggcacc       360
     agcaagggca agggcttcgc gggcacgatg aagcgccacg gcttcaaagg ccagggcgct       420
     tcgcacggcg cgcacaaagt gcaccgccgt ccgggttcca tcggcgcgtg cgccttcccc       480
     ggccgcgtgt tcaaaggcac ccggatggcc gggcgcatgg gcaacgcgaa gacgaccacg       540
     cagaacctca ccgtgttccg ggttgacccg gaggccggtg tgctcctcat caagggcgct       600
     gtccccggcc gtgacggcgg cttggtgttc atccgctccg ctgtgaagaa aggggtggcg       660
     aagtga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page