(data stored in ACNUC7421 zone)

EMBL: CP001958.PE147

CP001958.PE147       Location/Qualifiers
FT   CDS_pept        138877..139191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0151"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: rer:RER_18540
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96640"
FT                   /db_xref="GOA:D6ZA98"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA98"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ADG96640.1"
FT                   /translation="MTIASIPADPHDVLIRPVVSEKSFALAEQKTYSFVVHPEANKTQV
FT                   KLAVEKVFGVKVARVNIMNRNGKRKRTRFGVGKRADTKRALVSLTESSKTIDIFTTAGA
FT                   "
     atgaccatcg caagcatccc ggctgatccg cacgacgtgc tgatccggcc tgtggtgagc        60
     gagaagtcgt tcgccttggc cgagcagaag acctacagct tcgtcgtgca ccccgaagcc       120
     aacaagaccc aggtgaaact ggccgtcgag aaagttttcg gcgtgaaggt ggcgcgggtg       180
     aacatcatga accgcaacgg caagcgcaag cgcacccggt tcggcgtcgg caagcgcgcc       240
     gacaccaagc gggcgctcgt ctccttgacc gagtcgagca agaccatcga catcttcacg       300
     acggccggcg catag                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page