(data stored in ACNUC7421 zone)

EMBL: CP001958.PE150

CP001958.PE150       Location/Qualifiers
FT   CDS_pept        140338..140823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0154"
FT                   /product="ribosomal protein L22"
FT                   /note="KEGG: gbr:Gbro_3753 ribosomal protein L22; TIGRFAM:
FT                   ribosomal protein L22; PFAM: ribosomal protein L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96643"
FT                   /db_xref="GOA:D6ZAA1"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA1"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ADG96643.1"
FT                   /translation="MSTVQDNPTAHASLKGARFSATKARRVIDLIRGKRVDEALAILRF
FT                   APQSASEEVSKVLASAVANAEHNLNLHRSTLVVSKAFADEGPTLKRYQPRAQGRSFRIR
FT                   KRTAHITIEVAAALANERPSRAKRVAGSKQGASKKTESKKTESKKTAATATEKGGEE"
     atgagcactg tccaagacaa cccgaccgcg cacgcctcgc tcaaaggcgc gcgtttctcg        60
     gcgaccaaag cccgccgggt catcgacctg atccgaggca agcgcgtgga cgaggcgttg       120
     gccatcctgc gcttcgcccc gcagagcgcg agcgaagagg tctccaaagt cctcgcgagc       180
     gcggtcgcca acgccgagca caatttgaac ctgcaccgct cgaccctggt ggtctcgaag       240
     gcgttcgcgg acgagggccc gaccctcaag cgttaccagc cgcgcgccca gggccgcagc       300
     ttccgcattc gcaagcgcac cgcgcacatc accatcgagg tggcggccgc gctcgccaac       360
     gagcggccga gccgcgccaa gcgcgtcgcc ggttccaagc agggcgcgtc caagaaaacc       420
     gagtccaaga agaccgagtc caagaaaact gcggcaaccg cgaccgagaa gggaggcgag       480
     gagtaa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page