(data stored in ACNUC7421 zone)

EMBL: CP001958.PE151

CP001958.PE151       Location/Qualifiers
FT   CDS_pept        140824..141672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0155"
FT                   /product="ribosomal protein S3"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3- domain protein; Ribosomal protein S3 domain; KH
FT                   type 2 domain protein; KEGG: gbr:Gbro_3752 ribosomal
FT                   protein S3; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96644"
FT                   /db_xref="GOA:D6ZAA2"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA2"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ADG96644.1"
FT                   /translation="MGQKIHPHGFRLGITTDWRSRWFADKQYKDYIKEDIQIRKLLVSG
FT                   MERAGIAKVEIERTRDRVRVDIHTARPGIVIGRRGAEADRIRGQLEKLTGKQVQLNILE
FT                   VKNSETIAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRHQQVKGIKVMCGGRLGGAEMS
FT                   RSEYYREGRVPLHTLRADIDYGFHEAKTTFGRIGVKVWIYKGDIVGGRVEHAAQLAAAE
FT                   EAGARRDRAARPRRSGASGTTATSTEAGRAGQGPSDPSAAEPVAAAPAAESVANESGQE
FT                   A"
     atgggacaga aaatccatcc ccatggcttc cgcctgggca tcaccactga ttggcgctcc        60
     cgttggttcg ccgacaagca gtacaaggac tacatcaaag aggacatcca gatccgcaag       120
     ctgctcgtgt cgggcatgga gcgggccggt atcgcgaagg tcgagatcga gcggacccgt       180
     gaccgggtgc gcgtggacat ccacaccgcc cgtccgggca tcgtcatcgg ccgccgcggc       240
     gccgaggccg accgcatccg gggccagttg gagaagctca ccggcaagca ggtgcagctg       300
     aacatcctgg aggtcaagaa ctccgagacc atcgcccagc tcgtcgcgca aggcgtcgcc       360
     gagcagctgt cgaaccgcgt ggcgttccgt cgcgcgatgc gcaaagcgat ccagtccgcg       420
     atgcgccacc agcaggtcaa gggcatcaag gtgatgtgcg gcggccgtct cggcggcgct       480
     gagatgagcc ggtccgagta ctaccgcgag ggccgggtgc ccctgcacac cctgcgcgcc       540
     gacatcgact acggcttcca cgaggccaag accaccttcg gccggatcgg cgtgaaggtg       600
     tggatctaca agggcgacat cgtcggcgga cgggtcgagc acgccgctca gctcgccgcc       660
     gcggaagagg cgggcgcccg tcgcgaccgc gccgcccgcc cgcgccgctc cggagcctct       720
     ggcaccaccg cgaccagcac cgaggccggt cgcgctggcc aaggcccgtc cgacccctcg       780
     gcggcggagc ctgtcgcggc agcgcccgcg gcggagtctg ttgccaacga atcaggtcag       840
     gaggcctga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page