(data stored in ACNUC7421 zone)

EMBL: CP001958.PE153

CP001958.PE153       Location/Qualifiers
FT   CDS_pept        142092..142442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0157"
FT                   /product="ribosomal protein L29"
FT                   /note="KEGG: ach:Achl_2679 ribosomal protein L29; TIGRFAM:
FT                   ribosomal protein L29; PFAM: ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96646"
FT                   /db_xref="GOA:D6ZAA4"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA4"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ADG96646.1"
FT                   /translation="MAHRTKAADLRERGRDDLVEQLGKLKEEALHLRFQLATGQLAKNS
FT                   RVSEVKREIAQVYTVIRERELGLSAEPTAEQAKAKKAEKKTDKAEKTDKAEKAEKKESK
FT                   AKKSEKTEGEDA"
     atggcacacc gcaccaaggc cgctgatttg cgcgaacggg gtcgtgacga cctggtcgag        60
     caactcggca aactcaaaga agaagcgttg cacctgcgtt tccagctcgc caccggccag       120
     ttggccaaga acagtcgcgt cagcgaggtc aagcgggaga tcgcccaggt gtacaccgtg       180
     attcgcgagc gcgaactggg tttgtccgcc gagccgaccg ccgagcaggc gaaggcgaag       240
     aaggccgaaa agaagaccga caaggccgag aagaccgaca aggccgagaa agccgagaag       300
     aaagagtcca aggccaagaa gagcgagaag accgagggtg aggacgcatg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page