(data stored in ACNUC7421 zone)

EMBL: CP001958.PE154

CP001958.PE154       Location/Qualifiers
FT   CDS_pept        142439..142729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0158"
FT                   /product="30S ribosomal protein S17"
FT                   /note="KEGG: gbr:Gbro_3749 30S ribosomal protein S17;
FT                   TIGRFAM: 30S ribosomal protein S17; PFAM: ribosomal protein
FT                   S17"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96647"
FT                   /db_xref="GOA:D6ZAA5"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA5"
FT                   /inference="protein motif:TFAM:TIGR03635"
FT                   /protein_id="ADG96647.1"
FT                   /translation="MSATKTEPTPQAARTSRRKVRSGVVVSDKMDKTIVVELVDRHRHP
FT                   LYGKIIRTTKKVKAHDEQQDAHIGDTVRIMETRPLSATKHWRLVEVLERAK"
     atgagcgcca caaagactga accgacgcca caggccgcgc gcacctcgcg ccgcaaggtc        60
     cgctcgggcg tcgtcgtttc ggacaagatg gacaagacca tcgtcgtgga gcttgtggac       120
     cgccaccggc acccgctgta cggcaagatc atccggacca cgaagaaggt caaggcccac       180
     gacgagcagc aggacgccca tatcggcgac accgtgcgga tcatggagac ccggcccctg       240
     tccgcgacga agcactggcg cttggtcgag gtgttggagc gggccaagta g                291
//

If you have problems or comments...

PBIL Back to PBIL home page