(data stored in ACNUC7421 zone)

EMBL: CP001958.PE155

CP001958.PE155       Location/Qualifiers
FT   CDS_pept        142851..144602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0159"
FT                   /product="protein of unknown function DUF1023"
FT                   /note="PFAM: protein of unknown function DUF1023; KEGG:
FT                   rop:ROP_19500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96648"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA6"
FT                   /inference="protein motif:PFAM:PF06259"
FT                   /protein_id="ADG96648.1"
FT                   /translation="MNLGDIRRVDTGAFGDLATSLSSRVASIQDAQGSFAKITQFPGWS
FT                   GAAKDAATQNFQNIDTSLLDDIARLSAVREAVSELHDDFTQLQTELRALEQEADALGAT
FT                   IDDNGFVHDKPDAHISDAQRARIANLSAEVAEVIRAANRLDEKAADVLKRATDGTITAG
FT                   GAADDAQAAHAGEQQGELGVADPPPGKGSPDANTGWWNSLPPKQRQWVIDNHPDWIGGR
FT                   DGVSASARDAANRTLIPAERARLTAERDRLQRELDSNPFGGAFSDKDAQLWYVKKKLDD
FT                   LDAIDRSLNQYGKDAKLLVLDMRSGERGKAAIALGDPDTADHISVTTPGLDSSVGGSLN
FT                   GMVGEASDLKSETERILRAQGKPGETVSTIAWIGYQCPHVDGPGWGDWARGGADVSQDT
FT                   LAKAGAQDLSRFYQGLNAAWHPSDGRADTGPQITALGHSYGSLTTSLALQQTPPGVVQN
FT                   AVLYGSPGIEADSAQQLHMQAGHIFAMQGDGDTIKLAAGTGNFGADPSVQSWVTRLSTH
FT                   EGITLGDSLDGIGVRHEGIQQNGHEHSQYPQNGSNGELRMPGYNMAAVVAGMTGDDGRK
FT                   DVTQHGE"
     atgaacctcg gggacattcg gcgtgtggac acgggggcat tcggcgatct cgcgacgagc        60
     ctgtcgtcgc gggtcgcgtc gattcaggac gcccagggct cattcgcgaa gatcacgcaa       120
     ttccccggat ggagcggcgc cgccaaggac gcggccacgc agaacttcca gaacatcgac       180
     acaagcctgc tcgacgacat tgcgcgcctc tcggcggtgc gagaggcggt ttcggagctc       240
     cacgacgatt tcacccagtt gcaaacagag ctgcgagccc tcgaacagga ggcggacgcg       300
     ctcggcgcga ctatcgacga caacggtttc gtgcacgaca agccggacgc gcacatctcg       360
     gacgcgcagc gcgcccggat cgcgaacctg tccgccgagg tcgcggaagt catccgggcg       420
     gcgaaccgct tggacgagaa agcggccgac gtgctcaaga gagcgacgga cggaacgatc       480
     accgccgggg gagccgccga cgacgcccag gccgcgcacg ccggagagca gcaaggggag       540
     ctcggcgttg cggacccgcc gccgggcaag ggaagccccg acgccaacac cggctggtgg       600
     aactcgctcc ccccgaagca acgccagtgg gtgatcgaca accacccgga ttggatcggg       660
     ggcagggacg gggtctccgc gagcgcgcgc gacgccgcca accgcacgct catcccggcg       720
     gagcgggcgc gattgaccgc ggagcgggac cgattgcagc gcgagctgga cagcaacccc       780
     ttcggcggcg cgttcagcga caaggacgcg cagctctggt acgtgaagaa gaaactcgac       840
     gacctcgacg cgatcgacag gtcgctgaac cagtacggga aagacgctaa attgctggtg       900
     ctcgatatgc ggtcaggaga gcgcggcaag gccgccatcg cgctcggcga cccggacacc       960
     gccgaccata tttcggtcac cacgccgggg ttggactcct ccgtcggtgg cagtctcaat      1020
     gggatggtcg gcgaggcaag cgatctcaag agcgaaaccg agcgaattct gcgggcacag      1080
     ggcaagcccg gcgagaccgt gtcgacgatc gcgtggatcg gctaccagtg cccccacgtt      1140
     gacggccccg ggtggggcga ctgggcgcgc ggcggcgcgg acgtcagcca ggacaccttg      1200
     gcgaaggcgg gggcgcagga tctcagccgg ttctaccagg ggctcaacgc ggcatggcat      1260
     ccgtcggacg ggcgtgcgga cacggggccg cagatcaccg cgctcgggca ctcctacggc      1320
     tcgctcacca cctccctcgc cttgcagcag accccgccgg gtgtggtgca gaacgcggtg      1380
     ctctacggct cgccggggat cgaggcggac tcggcccagc agttgcacat gcaggccggg      1440
     catattttcg cgatgcaggg cgatggcgac accatcaagt tggctgccgg aacggggaat      1500
     ttcggcgcgg acccctctgt gcagtcctgg gtgacccggc tgtccaccca tgagggcatc      1560
     acgctcggtg acagcctgga cggcatcggt gtgcgccacg agggcatcca acagaatggg      1620
     cacgagcact cgcaataccc ccagaacggg tccaacggag aattgcggat gccggggtac      1680
     aatatggccg ctgtggttgc cgggatgacc ggggacgacg gccgcaagga tgtcacccag      1740
     catggggagt ga                                                          1752
//

If you have problems or comments...

PBIL Back to PBIL home page