(data stored in ACNUC7421 zone)

EMBL: CP001958.PE158

CP001958.PE158       Location/Qualifiers
FT   CDS_pept        145593..146252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro02234 lipoprotein LppV"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96651"
FT                   /db_xref="InterPro:IPR032018"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96651.1"
FT                   /translation="MSTDDTMRAGGSSAPRRSWWRRVWKRVLVVLLVLAVCCGGGCVAL
FT                   RKLVDSLDPNPKHMTKEQVAAFEARYLDKGTAEQEARNLEDLLARTGDEIVALVPGLKW
FT                   SWNRDWGRLSCPGDAASDTQVVQIWVRQLVFDGPIPPGVWPQAVAVVRRAAASYGATKY
FT                   QNFIDKPDNRDVNFYSPEGARIGLTSAVLAVLIGVTPCRLPEWYFTERHLPVPAGK"
     atgagcacag acgacaccat gcgcgcgggt gggagttccg ctccgcgccg ctcgtggtgg        60
     cggcgggtgt ggaagcgggt gctggttgtg ctgctggtgc ttgcggtgtg ttgcgggggc       120
     gggtgtgtgg cgttgagaaa gttggtggat tctttggacc cgaatccgaa gcatatgacc       180
     aaggagcagg tggcggcgtt cgaggcgcgc tacttggaca agggcacggc ggagcaggag       240
     gcgcgcaacc tggaagacct tttggcgcgg acgggcgacg agatcgtcgc cctcgtgccc       300
     gggctgaagt ggagctggaa tcgcgactgg ggccgtctta gttgcccagg ggatgctgcg       360
     agcgatacac aagttgtcca gatttgggtg cgacaactgg tgttcgatgg tccgattccg       420
     cctggggtgt ggccgcaggc ggtggcggtc gtgcgccgcg cggcggcgtc ctatggcgcg       480
     acgaagtatc agaatttcat cgacaagccg gacaaccggg atgtgaactt ctacagcccg       540
     gagggggcga ggatcggcct gacctcggct gtcttggcgg tattgatcgg ggtcacgccg       600
     tgccggttgc cggaatggta tttcaccgag cgccacctcc cggtcccggc cggcaagtaa       660
//

If you have problems or comments...

PBIL Back to PBIL home page