(data stored in ACNUC7421 zone)

EMBL: CP001958.PE163

CP001958.PE163       Location/Qualifiers
FT   CDS_pept        150406..151941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0167"
FT                   /product="protein of unknown function DUF43"
FT                   /note="PFAM: protein of unknown function DUF43; KEGG:
FT                   sen:SACE_6413 methyltransferases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96656"
FT                   /db_xref="InterPro:IPR002723"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAB4"
FT                   /inference="protein motif:PFAM:PF01861"
FT                   /protein_id="ADG96656.1"
FT                   /translation="MALADIALLLARQTACNRQHLAVLARLLAGGASLQELIDAAALSR
FT                   RGVEAFLRVAGEDVVADADGRQGLRPQAREGYEALLASASRPELRPELLEELRAARARA
FT                   PKPNRNLDHVAATAETVLRRASWIARRFETNGLRVLFVGDHDLTSLAVAKLCPSADIAV
FT                   VDIDEALVEFLAAELSSSGAKFRVRHADLRQRFPADLEAWADLFVADPPYTPDGVALFC
FT                   ARGAQGLRCLAQGRGLVAYGYGEAQPALGLAVQKAIVGLDCLVEELIPDFNRYQGAQAI
FT                   GSASDLHLLRFAPSAAKKVDRIASGGAPAAIYTHGRQSVESSAAAGALDLRKHEPSALF
FT                   RALLWEQGDQLALLVDNNHPDVRSADAQARLREDFAEKWNLRLRKSAPDSVSAIIEADA
FT                   VGGAGPRGLVLARPHGKVKNVLREALVRSAGGRTKNQARELVGSILASLGPWGEGVGEC
FT                   VVGDAPRAMLRTVLHAMENAVSHAMENAVLHAMGDAVSHAMEDAARGARQEGT"
     gtggcgctgg ctgacatcgc cctgctgctc gcgcggcaga cggcgtgcaa ccgtcagcac        60
     ctcgccgttc tcgcccggct cctcgcgggc ggggccagtc tgcaagagct catcgacgcg       120
     gcggcgcttt cccgccgagg agtcgaagcg ttcctgcgcg tcgccggtga ggacgttgtc       180
     gccgatgcgg acggtcggca ggggctgcgg ccgcaggctc gggaggggta cgaggcgctg       240
     ctcgcgtcgg cttcccgccc agaactccgg ccggagctgt tggaggagct gcgcgcggcg       300
     cgcgcccgcg cgccgaagcc gaacaggaac ctcgaccatg tcgcggccac agcggaaact       360
     gtcctgcggc gggcgtcgtg gatcgcgcgg cgtttcgaga cgaacggtct gcgcgtcctt       420
     ttcgtggggg accacgatct caccagcctt gcggtggcga agctctgccc ttcggcggac       480
     atcgctgttg tggacatcga cgaggcgctt gtggagttcc tcgccgccga actgtccagt       540
     tccggagcga aatttcgtgt tcgccacgcc gatctgcggc aaaggttccc cgccgatctc       600
     gaagcatggg ccgacctgtt cgtggccgac ccgccgtaca cgccggacgg cgtggcgttg       660
     ttctgcgcgc gcggcgccca gggcttgcgg tgcctcgcgc aggggcgcgg gcttgtggcg       720
     tacgggtacg gcgaggccca gcccgcgctc ggcctcgccg tgcagaaggc cattgtcggc       780
     ctggactgcc tcgtcgaaga gctcattccc gacttcaacc gctaccaggg cgcgcaagcg       840
     atcggcagcg cgagcgacct gcatctgttg cgtttcgccc ccagcgcggc caagaaagtc       900
     gaccggatcg cctcgggggg agcccctgcg gcgatctaca cccatggtcg gcagtcggtg       960
     gagtcgtcgg ctgcggcggg ggcgctggat ctgcgcaagc acgagccgtc agcgctgttc      1020
     cgcgctctgt tgtgggaaca gggcgaccag ttggcgctgc tcgtggacaa caaccatccc      1080
     gatgtgcgca gcgccgatgc tcaagcgcgg ctccgggagg atttcgcgga aaaatggaac      1140
     ctgcggttgc gcaaatccgc cccggattcc gtcagcgcga tcattgaggc cgacgctgtg      1200
     ggcggggctg gtccgcgcgg gctcgtcctc gcgcgtccgc acggcaaggt gaagaacgtg      1260
     ctgcgggagg cgctggtccg ctcggccggc gggcggacga aaaatcaggc gcgggagctg      1320
     gtcgggagca ttctggcttc gctcgggccg tggggcgagg gggttgggga gtgcgtggtc      1380
     ggggacgcgc cgagggcaat gctgcgcacc gtgttgcacg cgatggagaa cgccgtgtcg      1440
     cacgcgatgg agaacgccgt gttgcacgcg atgggggacg ccgtgtcgca cgcgatggag      1500
     gacgccgcgc gtggagcgcg gcaggaagga acctga                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page