(data stored in ACNUC7421 zone)

EMBL: CP001958.PE164

CP001958.PE164       Location/Qualifiers
FT   CDS_pept        151941..152477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0168"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   nfa:nfa45760 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96657"
FT                   /db_xref="GOA:D6ZAB5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAB5"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG96657.1"
FT                   /translation="MATNTAAPGPRAGIVRRARPEDVPAMRAMVYDLAVYEKAPEQCHL
FT                   TEEQLHASLFGERPAVFAHVAVSPEEESRHDTPGEVVGMAVWFLNYSTWDGVHGIYLED
FT                   LYVRPQSRGSGLGKQLLAALAGECVRNGWSRLSWSVLDWNAPAIGFYQSIGAKAQDEWT
FT                   TYRLCGPELRALAEG"
     atggcgacga acactgcggc tccgggcccg cgcgcgggca ttgtccgccg ggcgcggccc        60
     gaggatgtgc ccgcgatgcg cgcgatggtc tacgacctcg ccgtctacga gaaggccccc       120
     gaacaatgcc atctcaccga ggagcagttg cacgcgtcgc tgttcggcga gcgtcctgcg       180
     gtgttcgccc acgtcgcggt gtcgccggag gaggagtcgc ggcacgacac gcccggcgag       240
     gtcgtcggca tggcggtgtg gttcctcaac tactccacct gggacggcgt gcacgggatc       300
     tacctcgaag acctctacgt gcgtccgcag agccggggct cggggctcgg gaaacagctg       360
     ctggccgcct tggccgggga atgcgtccgc aacggctggt cccggctcag ctggtcggtg       420
     ctcgactgga acgccccggc gatcgggttc taccagtcca tcggggcgaa agcccaggac       480
     gaatggacca cgtaccggct ctgcgggccg gagcttcgcg cgctggccga ggggtga          537
//

If you have problems or comments...

PBIL Back to PBIL home page