(data stored in ACNUC7421 zone)

EMBL: CP001958.PE167

CP001958.PE167       Location/Qualifiers
FT   CDS_pept        154686..157136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0171"
FT                   /product="hydrolase CocE/NonD family protein"
FT                   /note="KEGG: nfa:nfa51880 putative peptidase; TIGRFAM:
FT                   hydrolase CocE/NonD family protein; PFAM: peptidase S15;
FT                   X-Pro dipeptidyl-peptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96660"
FT                   /db_xref="GOA:D6ZAB8"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAB8"
FT                   /inference="protein motif:TFAM:TIGR00976"
FT                   /protein_id="ADG96660.1"
FT                   /translation="MDNGFARCFARWLGTGFASAGLTAAAWLTASAAASADETAASSEG
FT                   AGAFAPIAPLRDSGLIASNARVAAEADDEANLAAEAPDDADDEASAQDVDVDEREAADA
FT                   NDPKYPDQFTLGDLENQWSDTWENDLQYTNIGIDWDVPITMSDGTVLKANVYRPLNDDG
FT                   TPVDEQLPVIVNITPYTKLASMAIDSIMIPHYGENWVNFFGDMYMPPGLKGLEQLLQGF
FT                   NSGFFQELGVDRRLLQSGYAQVVVDQRGTGFSQGTWQVLGKREQLDDKEVVEWASEQPW
FT                   SNGKVGMTGVSYSAINQLQAAQQHPKGLKALFPVVPSADLVADVVAPGGGVGVGFLPYW
FT                   LSLINFMKVLPDLSASAGGTYDWQWADDRRKEVFVKLDLLAQALNTPDIDKVAEYYLDS
FT                   LDEDSPILQEVQRRQAQGQSMGQILVAIARTGSPWRDKALSEGDPHRIPLDVANFADET
FT                   SPWRKDLITDVSKVDVPTFVVGGWHDLFVNSEVRLLNELPLPPSEKKVLIGDWYHFTTG
FT                   SGLGKYPNPPRMDVLARAWFDHWLKGIDNGIDTFAPATFFSQSGGSGVWTNADEWPRKG
FT                   MEYQKLYLSGQQAMSTAFSMLDGSLAEQPDEDENGHWISFGLTNMCSRDMNQPFLGFMA
FT                   WIDACHIDSRIAELNGLTFTSAPVEEQTVISGPIAVHLNTVQQNKDGYWDVTVNDVDEF
FT                   GQSTVLSTGQLVVSLRGLNESKTTRLPDGTVVDPYPVLDFANWRPVEPGDPTPIDVGVV
FT                   PTDATLEPGHRLRVDVFASNFPKSIPIWPLMDDMRLAPQLLELDPDSPSWVVLPVNRNI
FT                   PGVS"
     atggacaatg gatttgcgcg ctgtttcgcg cgttggctcg gcactggatt cgccagcgcc        60
     gggttgacgg cagctgcttg gctcaccgcg agcgcggcag cgtcggcgga cgagaccgcc       120
     gcgtcttcgg aaggggcagg ggcgttcgcg cccatcgccc cattgcgcga cagcggcctg       180
     atcgcgtcga acgcccgtgt cgccgcggaa gcggacgacg aggccaatct cgcggcagag       240
     gctcccgacg acgccgacga cgaggcgtcc gcgcaggacg tggacgtgga cgagcgggag       300
     gccgccgacg cgaacgatcc gaagtatccg gaccagttca cgctgggcga cttggagaac       360
     cagtggtccg acacctggga gaacgacctg cagtacacga acatcgggat cgactgggac       420
     gtgccgatca cgatgagcga cggaacggtg ctcaaagcga acgtctaccg tccgctcaac       480
     gacgacggca caccggtgga cgaacagctg ccggtgatcg tgaacatcac cccgtacacc       540
     aagctggcct cgatggccat cgactcgatc atgatccccc attacgggga gaactgggtc       600
     aacttcttcg gcgacatgta catgccgccc ggcctgaagg ggctcgaaca gttgctgcaa       660
     ggcttcaact ccgggttctt ccaggagctc ggcgtcgacc gcaggctgtt gcaatcgggc       720
     tacgcgcagg tggtggtcga ccagcgcggc accggcttct ctcagggaac ctggcaggtg       780
     ttgggcaagc gcgagcagct cgacgacaag gaagtcgtgg agtgggcctc ggaacagccg       840
     tggtcgaatg gcaaggtcgg gatgaccggt gtctcgtatt ccgccatcaa ccagctgcaa       900
     gcggcccaac agcatccgaa gggcctcaag gcgctcttcc ccgtcgtgcc gagcgcggac       960
     ctcgtcgcgg acgtggtggc cccgggcggc ggcgtcggcg tcggcttcct gccctactgg      1020
     ttgtcgctga tcaacttcat gaaagtgctc ccggacctgt cggccagcgc ggggggcacc      1080
     tacgactggc agtgggccga cgaccggcgc aaagaggtct tcgtcaagct cgaccttctg      1140
     gcccaggcgt tgaacacccc ggacatcgac aaagtggcgg agtactacct tgactccctt      1200
     gacgaggact cgccgatctt gcaggaggtg cagcgccgcc aagcgcaagg ccagagcatg      1260
     ggccaaatcc tggtcgccat tgccaggaca ggctcgccgt ggcgggacaa ggcgctgagc      1320
     gaaggcgacc cgcatcggat tcccctggat gttgccaatt tcgcggacga aacctccccg      1380
     tggcgcaagg acttgatcac cgacgtgagc aaggtcgacg tgcccacttt cgtggtgggc      1440
     ggctggcacg acctcttcgt caacagcgag gtgcgcctcc tgaacgagtt gccgctgccg      1500
     ccgagcgaga agaaagtcct catcggcgac tggtaccact tcacgaccgg atccggcctc      1560
     gggaaatacc cgaacccgcc gagaatggac gtgctcgccc gagcatggtt cgaccactgg      1620
     ctgaaaggca ttgacaacgg gatcgacaca ttcgcgcccg ccaccttctt cagccagtcc      1680
     ggcgggagcg gagtgtggac gaacgccgac gagtggccgc gcaaaggcat ggagtaccag      1740
     aagctgtacc tttccggcca gcaggcgatg tccaccgcgt tctcgatgct cgacgggtcc      1800
     ctcgcggaac agcccgacga ggacgagaac gggcattgga tctcgttcgg tttgacgaac      1860
     atgtgctcgc gggacatgaa ccagcccttc ctcggtttca tggcctggat cgacgcctgc      1920
     catatcgact cgcggatcgc ggagctcaac ggcctgacct tcaccagcgc cccggtcgag      1980
     gagcagacgg tgatctccgg ccccatcgcg gtgcacctga acacggtgca acagaacaag      2040
     gacgggtatt gggatgtgac ggtcaacgac gtggacgagt tcggccagtc cacagtcctc      2100
     tccaccggcc agctcgtggt ctcgctgcgc ggcttgaacg agtccaagac cacgcgcctg      2160
     ccggacggca ccgtcgtgga cccgtacccg gtcctcgact tcgccaactg gcgcccggtc      2220
     gagccgggcg acccgacgcc gatcgacgtc ggggtcgtcc ccaccgacgc gacgttggag      2280
     ccggggcacc ggttgcgcgt ggacgtgttc gccagcaact tccccaagtc gatcccgatc      2340
     tggccgttga tggacgacat gcgcctggcc ccccagctgc tcgaactcga ccccgactcc      2400
     ccgagctggg tcgtgctccc cgtcaaccgc aacatcccag gagtgtcctg a               2451
//

If you have problems or comments...

PBIL Back to PBIL home page