(data stored in ACNUC7421 zone)

EMBL: CP001958.PE17

CP001958.PE17        Location/Qualifiers
FT   CDS_pept        19456..20775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0017"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: mmi:MMAR_0770
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96510"
FT                   /db_xref="GOA:D6Z9I3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I3"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ADG96510.1"
FT                   /translation="MNVPRVPPRAVAVIGSGVAGLTAAYVLSRSCKVVLYEADNRIGGH
FT                   AHTHLVEQGDGSSVAVDSAFLVHNDRTYPTLCRLFQELGVATQETDMSMSVRAERSGFE
FT                   YAGSRGVRGLFPSLGAVQPRHIMMLAEVAKFHRAAAQLLRSGPDEEEPLGEFLARHSFS
FT                   RRFTDYFMTPLVAAVWSCDPRDALRYPARFLFVFLEHHGMLSVFGSPTWRTVTGGSARY
FT                   VERIAARLSEVRTNAPVRSVRRVAGGVSVQAAAEPPRHFDAAVIAAHSDQALAMLAEPT
FT                   ADERRILGKMAYSTNHAQLHTDASLLPKHRFARASWNYLIPAAAHGSEGVLVTYDISRL
FT                   MRVRGADGRRFLVSLGAERRVAPESVIAEMTYHHPLYTPEFVAAQRSLPTLGDDRVVFA
FT                   GAYHGWGFHEDGAASGLRAAQRLGADWKTAEAGREELAQC"
     atgaacgtcc cccgcgtccc tcctcgcgcc gtcgcggtca tcggcagcgg cgtcgccggc        60
     ctcacggcgg cgtacgtgct ctcccgcagt tgcaaggtcg tcctgtacga ggccgacaac       120
     cggattggcg ggcatgcgca cacccatctc gtcgaacagg gcgacgggtc ctccgtggcg       180
     gtggactccg ccttcctcgt ccacaacgac cgcacctacc ccacgctctg ccgcttgttc       240
     caagaactcg gggtcgccac ccaagagacc gacatgtcga tgtcggtgcg ggccgagcgc       300
     agcggattcg agtacgcggg ctcgcgaggc gtgcgcggcc tgttcccctc cctgggcgcg       360
     gtccagccgc gtcacatcat gatgctggcc gaagtcgcca agttccaccg cgccgccgcg       420
     cagctgctgc gcagcggccc cgacgaggag gagccgctcg gggaattcct cgcccggcac       480
     tcgttctccc ggcggttcac cgactatttc atgacgccgc tcgtggccgc ggtgtggtcc       540
     tgcgacccgc gcgacgcgtt gcgctacccg gcgcgtttct tattcgtctt cctcgaacac       600
     cacgggatgc tctccgtgtt cgggtccccg acatggcgca ccgtgaccgg cggctcggcc       660
     cggtatgtcg agcggatcgc cgcccgattg tccgaggtgc gcacgaacgc ccccgtgcgc       720
     tcggtgcggc gcgtcgcggg cggcgtgagc gtccaagccg cagcggaacc gccccggcat       780
     ttcgacgccg cggtgatcgc cgcccattcg gaccaggcct tggcgatgct ggccgagccc       840
     accgccgacg aacgccgaat actggggaag atggcctact ccacgaacca cgcccaactg       900
     cacaccgacg cgtcgctgct gccgaagcac agattcgcga gggcctcgtg gaactacctc       960
     atccccgccg ccgcgcacgg cagcgaaggc gtgttggtca cctacgacat ttcgaggctg      1020
     atgcgtgttc gaggggcgga cgggcggcgc tttttggtct cattgggcgc cgagcgccgc      1080
     gtcgcgcccg aatccgtcat cgcggaaatg acctaccacc acccgctgta cacgccggaa      1140
     ttcgtcgccg cccaacggtc cctgccgacg ctcggcgacg accgcgtggt cttcgcgggc      1200
     gcctaccacg gttggggctt ccacgaggac ggcgccgctt ccgggcttcg ggcggcgcaa      1260
     cggttgggag ccgactggaa gaccgcggag gcgggccggg aggagctggc gcaatgctga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page