(data stored in ACNUC7421 zone)

EMBL: CP001958.PE171

CP001958.PE171       Location/Qualifiers
FT   CDS_pept        159292..159972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0175"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: dze:Dd1591_3141
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96664"
FT                   /db_xref="GOA:D6ZAC2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAC2"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADG96664.1"
FT                   /translation="MAEILDFSELVRARHSVRAFLPEPLSKEELDGVLGDAQRSPSNSN
FT                   TQPWRVHIVSGAKRDELRAALLDAAARGETSLDFSFDPKYGQNEVLLEHMRQFGQVYYE
FT                   TMGVSRDDAEGRSKLMLRNLGFFNAPHVAFLFLPVVGDSVRVAADIGMYAQTFLLSLVA
FT                   RGFGGIPQTMLGHFANTVREVLGISEEHKLLFGISFGRPDESALENSFRVDRTPVEHSV
FT                   VLHS"
     atggcagaaa ttctggactt ctccgaactc gttcgggccc ggcattcggt tcgcgcgttc        60
     ttgccggagc ccctgtcgaa agaggagctc gacggggtgc tcggggacgc gcagcggtct       120
     ccgtcgaaca gcaacacgca gccttggcgc gtgcacatcg tctccggggc caagcgcgac       180
     gagctccgcg ctgcgttgtt ggacgcggcc gcgcgcggcg agacgagctt ggatttctcc       240
     ttcgacccca aatacggcca gaacgaagtg ctgctcgagc atatgaggca gttcgggcag       300
     gtgtactacg agacgatggg cgtgtcgcgg gacgacgccg agggccgcag caagctcatg       360
     ttgcgcaacc tggggttctt caacgccccg catgtggcgt tcctgttctt gccggtcgtc       420
     ggggacagcg tccgggtcgc ggcggacatc ggcatgtacg cgcagacatt cctgctctcg       480
     ctcgtcgcgc gcggtttcgg cggcatcccg cagaccatgc tcgggcactt cgccaacacg       540
     gtgcgcgagg tgctcgggat ctccgaggag cacaagctgc tcttcgggat ttcgttcggc       600
     cgaccggacg agtcggcgtt ggagaacagc ttccgcgtcg accgcacgcc cgtcgagcac       660
     agcgtggtgc tgcactcctg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page