(data stored in ACNUC7421 zone)

EMBL: CP001958.PE172

CP001958.PE172       Location/Qualifiers
FT   CDS_pept        160145..160960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_2657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96665"
FT                   /db_xref="GOA:D6ZAC3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022480"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAC3"
FT                   /inference="similar to AA sequence:KEGG:Mjls_2657"
FT                   /protein_id="ADG96665.1"
FT                   /translation="MPRPIRVSLFIPPTRLASYSAVRDQVTAAEETGADILFGYDHFFP
FT                   PEVTGFKDGVPELADPQPDLPNFEPLTALAAWAEQTSRPELGLLVTGVGYRNPDLLADI
FT                   ARTIDHISGGRHILGLGAGWYKPDYDEYGYEFGTFTTRFKLFEESLERITARFAKLNPA
FT                   PTRHIPVLIGGGGEKKTLPLVAKHADIWHSFSDLESLHRKKDILTGLLEQNGRAADAVE
FT                   ISQNWPGAEQADAYVAAGVTLFNVDYRLDDPEKVAAVREIIAWRDKANG"
     atgccccgtc ctatccgagt cagcctcttc atcccgccga cccggctcgc cagctacagc        60
     gctgttcgag accaggtcac ggcggccgag gaaacagggg cggacatctt gttcggctac       120
     gaccattttt tcccgccaga ggtgactggc ttcaaggacg gcgtgccgga gctcgccgac       180
     ccgcagcccg atttgccgaa tttcgagccg ctgacggcgt tggcggcgtg ggcggagcag       240
     acgagccggc cggagctggg gcttttggtc acgggagtcg ggtaccgcaa tcctgacttg       300
     ctcgcggaca ttgcgcggac catcgaccat atttccggcg gtcggcacat cctgggcttg       360
     ggcgcgggct ggtacaaacc ggactatgac gagtacggct acgagttcgg cacgttcacc       420
     acgcggttca agctgttcga ggagagcttg gagcgcatca cggcgaggtt cgcgaagctc       480
     aacccggctc cgacccggca tatccctgtc ttgatcggcg gcggtggtga gaagaagacg       540
     ttgccgttgg tcgcgaagca cgccgatatt tggcactcgt tcagcgactt ggaatcgctg       600
     catcgcaaga aagacattct gacgggtctt ttggagcaga acggccgcgc cgccgacgcc       660
     gtcgagatct cgcagaactg gccgggagcc gagcaggccg acgcgtacgt cgcggcgggc       720
     gtgaccctct tcaatgtcga ctaccggctg gacgaccccg agaaggtcgc ggcggtccgg       780
     gagatcatcg cgtggcggga caaggcgaac ggctga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page