(data stored in ACNUC7421 zone)

EMBL: CP001958.PE173

CP001958.PE173       Location/Qualifiers
FT   CDS_pept        160976..161209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0177"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Gm7921, EG666080; predicted gene 7921"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96666"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAC4"
FT                   /inference="similar to AA sequence:KEGG:666080"
FT                   /protein_id="ADG96666.1"
FT                   /translation="MRGGWAAPAAMRPASFWLLRAGSSASWMKAPRRAFASAWGEGGLD
FT                   GFGRVEPFGPDRDGGLLCREFFGRKRAHATYA"
     atgcgaggtg gctgggcggc tcctgcggcg atgcgccccg cgagcttttg gctgctgcgc        60
     gcgggctctt cggcgagttg gatgaaggcg ccgaggcggg ctttcgcttc ggcgtggggc       120
     gagggcggcc tcgacggctt cgggcgggtc gagccgttcg gcccggatcg cgacggcggt       180
     ttgttgtgcc gtgagttctt cgggcgcaag cgcgcccatg ctacttatgc gtaa             234
//

If you have problems or comments...

PBIL Back to PBIL home page