(data stored in ACNUC7421 zone)

EMBL: CP001958.PE174

CP001958.PE174       Location/Qualifiers
FT   CDS_pept        161413..162831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0178"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   svi:Svir_32050 nitrate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96667"
FT                   /db_xref="GOA:D6ZAC5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAC5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG96667.1"
FT                   /translation="MPSPTAEKVQTIEKAQTPSAGGTPFGFGEDEALGARTKMGIAAAR
FT                   ASSKAGIPPTLALGFLGLLFFMIGDGVESGFITPFIASHGGGAKAVAAYLITGYGVAVA
FT                   AASWLAGALSQVFGPKKVMWAGFGIWLVFDVVFLLAAMDHNFPLMALGYCVRGFGYPLF
FT                   AYGFLVWITAVTPKRRLGTAVGWFYFAFTGGFPTLGSLVASFAIPGFGQGDQERGEFGT
FT                   LWLAVGILAAGAFLALFGVRDKRGAEPTAGAGGRPFKSLLSSFTVAYHHPKVALGVLVR
FT                   MINTTPQYALLVLFPSVYTNLLGKGDPIAGSQKWLLLVAVIFGTNVGFNLVFGALSDRI
FT                   GWRPTIAWFGAVGSAATFSLFYFLTPLVGPDRFWLILVLGGAYGATLGGFVPISALVPQ
FT                   LAPENRGGAIAMLNLGAGASYFVGPGIVSLFLTLLGSGKFATTVIVLTLSATYCVAAPL
FT                   AFLLRAPDEEEAGA"
     gtgccttcgc cgacagccga aaaagtccag acgatcgaga aggcccaaac gccttctgcg        60
     ggagggactc cgttcggctt cggggaggac gaagcgctcg gcgcgaggac aaaaatgggc       120
     atcgccgcag cgcgcgcgag ttcgaaggcg gggattccgc cgaccctcgc cctcggcttc       180
     ctcggcctgt tgttcttcat gatcggcgac ggggtggaat ccgggttcat cacccccttc       240
     atcgccagcc acggcggcgg cgccaaggcg gtggccgcct atctcatcac cggctacggc       300
     gtcgcggtcg ccgccgcgtc ctggctcgcg ggcgcgcttt cgcaagtgtt cggccccaag       360
     aaggtcatgt gggccggctt cgggatctgg ctggtcttcg acgttgtttt cctcctcgcg       420
     gcgatggatc acaattttcc gctcatggcg ctcggctact gcgtccgggg cttcggctat       480
     ccgctgttcg cctacgggtt cctggtgtgg atcaccgcgg tcacccccaa acgccgcctc       540
     ggcaccgcgg tgggctggtt ctatttcgcg ttcaccggcg gcttccccac gttgggctcg       600
     ctcgtcgcga gcttcgcgat tccaggtttc ggccagggcg accaggagcg cggcgaattc       660
     ggcacattgt ggctggcggt cggcatcctc gcggccgggg cctttctggc cctgttcggc       720
     gtgcgcgaca aaaggggcgc ggagcccact gcgggggcgg gcgggcgccc gttcaaaagc       780
     ctgctgtcca gcttcaccgt cgcctaccac catcccaaag tcgcgctggg cgtgctggtg       840
     cggatgatca acacgacgcc gcagtacgcg cttctggtgc tgttcccgag cgtctacacc       900
     aatctgctcg gcaaaggaga cccgattgcc ggaagccaga agtggctgct gctggtcgcg       960
     gtcattttcg gcacgaacgt cggtttcaat ctggtcttcg gggcgttgtc cgaccgcatc      1020
     gggtggcgcc cgaccatcgc gtggttcggg gctgtcggca gcgcggcgac gttcagcctg      1080
     ttctatttcc tcaccccgct ggttggcccg gaccggttct ggctgatcct ggtcctcggc      1140
     ggcgcgtacg gggccactct cggcgggttt gtgccgattt ccgccctcgt cccgcagctg      1200
     gccccggaga accggggcgg ggcgatcgcg atgctcaacc ttggggccgg ggcctcctac      1260
     ttcgtcgggc cgggcattgt gagcctcttt ctcacgctgc tgggctccgg caagttcgcc      1320
     acgaccgtga tcgtgctgac gttgtcggcg acgtactgcg tcgcggctcc cctcgccttt      1380
     ctgctccgcg ccccggacga agaggaggcc ggggcgtag                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page