(data stored in ACNUC7421 zone)

EMBL: CP001958.PE176

CP001958.PE176       Location/Qualifiers
FT   CDS_pept        complement(163587..164705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0180"
FT                   /product="phosphoserine aminotransferase"
FT                   /note="KEGG: mlb:MLBr_02136 putative phosphoserine
FT                   aminotransferase; TIGRFAM: phosphoserine aminotransferase;
FT                   PFAM: aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96669"
FT                   /db_xref="GOA:D6ZAC7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAC7"
FT                   /inference="protein motif:TFAM:TIGR01366"
FT                   /protein_id="ADG96669.1"
FT                   /translation="MTALEIPSGLKPKDGRFGSGPSKVRPEQIQAIAASAATVLGTSHR
FT                   QAPVKNVVKRVRAGLKELYSLPDGYEVLLGNGGATFFWDAAAFGLIRERSLHLSFGEFS
FT                   AKFASVVAKHPDRKEPVVVQSDPGSAPAVPDSAPAEPVDVLAWAHNETSTGVTVPVARP
FT                   SWAKDELVVIDGTSAAAGVPLDVTQTDVYYFSPQKGFASDGGLWLALLSPAAIERVNEL
FT                   SGRWAPESISLPTALENSTKDQTYNTPAVATLVLLAEQIEWINGQGGLAWSTARTKDSS
FT                   SRLYDWAEQSEFATPFVTDPALRSPVVATIDFHEEVDAAKVAKTLRENGIVDTEPYRKL
FT                   GRNQLRLGVFPAVDPEDVTALTKAIDWVVERL"
     gtgactgctc ttgagattcc ctccggcctc aaacccaaag acggacgttt cggctccggc        60
     ccctcgaagg tccgccccga gcaaatccag gccatcgcgg cgagcgccgc gaccgtgctc       120
     ggcacgagcc accgccaagc gccggtcaag aacgtggtca aacgggtccg cgcggggctc       180
     aaagagctct attccctgcc ggacggctac gaggtgctgc tcggcaacgg cggcgcgacg       240
     ttcttttggg acgcggccgc gttcgggctg atccgcgagc ggtccctgca cctttctttc       300
     ggcgagttca gcgcgaagtt cgcgagcgtc gtcgccaagc accccgaccg caaagaaccg       360
     gtggtcgtgc aatccgaccc tggttcggct cctgccgtgc ccgacagcgc ccccgccgaa       420
     ccggtggacg tgctggcctg ggcgcacaac gagacctcca ccggggtgac ggtgccggtc       480
     gcgcgcccga gctgggccaa agacgagctt gtcgtcatcg acggcacctc cgccgccgcc       540
     ggcgtgccgc tcgatgtgac gcagaccgac gtgtattact tctccccgca gaaaggcttc       600
     gcctccgacg gcggcctctg gctggcgctg ctctcccccg ccgccataga gcgggtgaac       660
     gagctctccg ggcgttgggc ccccgagtcg atttccttgc cgaccgcgct ggagaacagc       720
     acgaaggacc agacgtacaa cactcctgcc gtcgcgacgc tggtgctgct cgccgagcag       780
     atcgaatgga tcaacggcca aggcgggctc gcctggtcca ccgcgcgcac caaggactcc       840
     tcgtcgcgcc tgtacgactg ggccgagcag agcgagttcg ccacgccgtt cgtcaccgac       900
     ccggcgttgc gctcccccgt ggtcgcgact atcgacttcc acgaggaggt ggacgcggcg       960
     aaggtcgcga agacgctgcg cgagaacggc atcgtggaca ccgagccgta ccgcaagctc      1020
     gggcgcaacc agttgcgttt gggcgtgttc ccggccgtgg acccggagga cgtcaccgcg      1080
     ctgaccaaag ccatcgactg ggtcgtcgaa cggctctga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page