(data stored in ACNUC7421 zone)

EMBL: CP001958.PE18

CP001958.PE18        Location/Qualifiers
FT   CDS_pept        20769..21470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0018"
FT                   /product="protein of unknown function DUF1365"
FT                   /note="PFAM: protein of unknown function DUF1365; KEGG:
FT                   mmi:MMAR_0769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96511"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I4"
FT                   /inference="protein motif:PFAM:PF07103"
FT                   /protein_id="ADG96511.1"
FT                   /translation="MLTPKLYRTEIAHTRLSPIRHEFRYRGYSWHVDVDNLPRLPLWLR
FT                   PFAGFQAKDHFTGQPQASLRERVDACLAANGLEPPGGPVTALVQARVLGYVFNPLSLYW
FT                   CHDTEGRLRHIIAEVHNTYGGRHAYPFQPDDKGGATLAKEFYVSPFNPVDGHYCIRAPE
FT                   PETDLDVSVVLRRAGAAVFVATMRGKALPATAGRLARLQLAAPLAPLVGSLRIRKQGIM
FT                   LWLRGLKVVPR"
     atgctgaccc cgaagctcta ccggacggag atcgcgcaca cccggttgtc gccgatccgc        60
     catgaattcc gctaccgcgg ctacagctgg cacgtcgacg tggacaacct gccgaggctg       120
     ccgctgtggt tgcgcccgtt cgccggcttc caagccaaag accatttcac cggccagccg       180
     caggcttccc tgcgcgagcg ggtggacgct tgtttggcgg ccaacgggct cgaaccgccc       240
     ggcggccccg tgaccgccct tgtgcaggcg agagtgctcg gctatgtgtt caatccgctc       300
     agcctgtatt ggtgccacga cacagagggc cggttgcgcc acatcatcgc ggaagtccac       360
     aacacctacg gcggtcgcca cgcctacccg ttccagcccg acgacaaagg cggggcgacg       420
     ctggcgaagg agttctacgt gtcgccgttc aaccccgtgg acgggcacta ctgcatacga       480
     gcccccgagc cagaaaccga cttggacgtc tccgtggtcc tgcgccgcgc cggagccgcc       540
     gtgttcgtgg cgaccatgcg cgggaaggcg ctgcccgcga cggcagggcg actggcccgg       600
     ttgcagttgg ccgcgccgct ggcccccctg gtcggatcgc tgcgaatccg caagcagggg       660
     atcatgctgt ggttgcgagg actgaaggtg gtgccccgat ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page