(data stored in ACNUC7421 zone)

EMBL: CP001958.PE180

CP001958.PE180       Location/Qualifiers
FT   CDS_pept        complement(167072..167674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0184"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="KEGG: rer:RER_06990 hypothetical protein; PFAM:
FT                   Allophanate hydrolase subunit 1; SMART: Allophanate
FT                   hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96673"
FT                   /db_xref="GOA:D6ZAD1"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD1"
FT                   /inference="protein motif:PFAM:PF02682"
FT                   /protein_id="ADG96673.1"
FT                   /translation="MRVMQAGTNALLIECEGQEQVFALYKRLRADRRFVEAVPGDRTLL
FT                   VVADSDIRDTGLVEEVHATEIHVTAEPPGPVVVVKVRYDGPDLAEVAELTGMSVREVVD
FT                   AHTGSAWTTQFLGFSPGFAYLANPEAGLAVPRRESPRARVPAGAVALGAAYCAVYPMAT
FT                   PGGWRLIGATDAPMWDPRRDPPALLAPGSTVVFEAVT"
     atgcgggtga tgcaggcggg cacgaacgcg ctgttgatcg aatgcgaggg ccaagaacag        60
     gtctttgcgc tgtacaaacg gttgcgtgcg gatcgcaggt tcgtggaggc ggtccccggc       120
     gaccggacgc tgctggtggt cgcggacagc gatattcgtg acacgggcct cgttgaagag       180
     gtccacgcga cagagatcca tgtgacggcc gaaccgccgg gcccggtcgt cgtggtcaaa       240
     gtccgttatg acggaccaga cctcgccgag gtggccgaac tgaccggcat gtcggtccgc       300
     gaagtcgtgg acgcgcacac cgggtcggcg tggacgacgc agttcctcgg cttcagcccc       360
     ggcttcgcgt acctcgccaa ccccgaggcc gggctcgccg tcccgcgccg ggagtcgccg       420
     cgagcgcgcg tccccgcggg cgcggtggcc ctcggcgccg cgtattgcgc cgtgtacccc       480
     atggcgacgc cgggcggatg gcggctgatc ggcgccacgg acgcgccgat gtgggacccg       540
     aggcgcgacc cgcccgcgtt gctcgcacct ggctcgacgg tggtgttcga ggcggtcaca       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page