(data stored in ACNUC7421 zone)

EMBL: CP001958.PE181

CP001958.PE181       Location/Qualifiers
FT   CDS_pept        167809..169137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0185"
FT                   /product="citrate synthase I"
FT                   /EC_number="2.3.3.1"
FT                   /note="TIGRFAM: citrate synthase I; KEGG: rha:RHA1_ro04998
FT                   type II citrate synthase; PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96674"
FT                   /db_xref="GOA:D6ZAD2"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD2"
FT                   /inference="protein motif:TFAM:TIGR01798"
FT                   /protein_id="ADG96674.1"
FT                   /translation="MSVAQPAERTDQNAVGAATLRYPGGEKELTVTPAVEGNAGVQLGD
FT                   LLASTGYVTYDEGFMNTASTKSAITYIDGEHGILRYRGYPIDQLAQKSTFLEVSYLLIY
FT                   GELPTAAQLEEFAHKISRHTMLHEDLKRFFDGFPRDAHPMPVLSSAVNALSAYYPDSVD
FT                   PSDPAQVEQSTLRLLAKLPTIAAYAYKKSVGQPFLYPDNSLNLVENFLRMTFGFPAEPY
FT                   DIDPNVVKALDMLFILHADHEQNCSTSTVRLVGSSNANLFTSVSGGINALWGPLHGGAN
FT                   QAVLEMLDQIKASGESASDFLAKVKDKKTRIKLMGFGHRVYRNYDPRAAIVKQTADQIL
FT                   NQLKVTDELLDIAKELEQAALTDEYFVSRKLYPNVDFYTGLIYRAMGFPDRMFTVLFAL
FT                   GRLPGWIAHWREMHDSGPLKIGRPRQIYTGQPERPYVSLTDRV"
     gtgtccgtag cccagcccgc agagcgtacc gaccagaacg cggtcggcgc tgcgacattg        60
     cgttacccag gcggtgagaa agagctgact gtgaccccgg cggtggaggg gaacgctggc       120
     gtccagctcg gcgacctttt ggcctccacc ggttacgtca cttacgacga aggcttcatg       180
     aacaccgcct cgacgaagtc ggcgatcacc tacatcgacg gcgagcacgg catcctccgc       240
     taccggggct acccgatcga ccagctggcg cagaagtcca ccttcctcga agtctcctac       300
     ctgctcatct acggggagct gccgacggct gcgcagctgg aggagttcgc ccacaagatc       360
     tcgcggcaca cgatgctgca cgaggacctc aaacgcttct tcgacggctt cccgcgcgac       420
     gcgcacccga tgccggtgct ctcctccgcg gtgaacgcgc tctcggccta ctacccggac       480
     tcggtcgacc cctccgaccc cgcccaggtg gagcagtcca cgctccgtct gctcgccaag       540
     ctgcccacta tcgcggccta cgcgtacaag aaatcggtcg gccagccttt cctgtacccg       600
     gacaactcgc tcaacctggt cgagaacttc ctgcggatga ccttcggctt ccccgccgag       660
     ccgtacgaca tcgacccgaa cgtggtcaaa gcgctcgaca tgctcttcat cctgcacgcg       720
     gaccacgagc agaactgctc cacctccacg gtgcgcctgg tcgggtcctc gaacgcgaac       780
     ctgttcacct cggtctccgg cgggatcaac gcgctgtggg ggccgctgca cggcggcgcc       840
     aaccaggcgg tcttggaaat gctcgaccag atcaaggcct ccggcgagag cgcgtcggac       900
     ttcctggcca aagtgaaaga caaaaagacc cggatcaagc tcatgggctt cggtcaccgc       960
     gtgtaccgca actacgaccc gcgcgcggcc atcgtcaagc agaccgccga ccagatcttg      1020
     aaccagctca aagtcactga cgagttgttg gacatcgcca aagagctcga acaggcggcg      1080
     ctcaccgacg agtacttcgt ctcgcgcaag ctgtacccga acgtcgactt ctacaccggg      1140
     ctcatctacc gcgcgatggg cttccctgac cgcatgttca ctgtgctgtt cgcgctgggc      1200
     cggctgcccg gctggatcgc gcactggcgg gagatgcacg actcggggcc gctcaagatc      1260
     ggccgtcccc gccagatcta caccggccag cccgaacgac cgtacgtttc gctcaccgac      1320
     cgggtgtga                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page