(data stored in ACNUC7421 zone)

EMBL: CP001958.PE184

CP001958.PE184       Location/Qualifiers
FT   CDS_pept        171233..171583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0188"
FT                   /product="protein of unknown function DUF1025"
FT                   /note="PFAM: protein of unknown function DUF1025; KEGG:
FT                   msm:MSMEG_6415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96677"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD5"
FT                   /inference="protein motif:PFAM:PF06262"
FT                   /protein_id="ADG96677.1"
FT                   /translation="MPVQISAESFERLVGEALDLIPPKLARAVDNVVVLIADRNPEEPD
FT                   LLGLYEGVPLGERGSDYGGSLPDVIHIYRDAILEICDSEDDVVDEVAITVVHEVAHYFG
FT                   VDDEKLHELGWG"
     gtgcccgtgc agatcagcgc cgagagcttc gagcggctcg tgggcgaagc cctcgacctc        60
     atccccccca agctcgccag ggcggtggac aacgtcgtgg tgctgatcgc ggaccgcaat       120
     cctgaagagc cggatctgct cgggctctac gagggcgttc cgctcggcga acgcggctcc       180
     gactacggcg ggtcgctgcc cgacgtcatc cacatctacc gggacgcgat tttggagatc       240
     tgcgacagcg aggacgatgt ggtggacgag gtcgcgatca ctgtcgtcca cgaggtcgcg       300
     cactacttcg gcgtcgatga cgagaagctt cacgagttgg gctggggctg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page