(data stored in ACNUC7421 zone)

EMBL: CP001958.PE186

CP001958.PE186       Location/Qualifiers
FT   CDS_pept        complement(172103..172543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0190"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   mab:MAB_1888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96679"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD7"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADG96679.1"
FT                   /translation="MTASPASHPQQAACVQIQLRFGDMDALGHVNNVAVLRVFEEARVR
FT                   LISGQLRLEGVSALVARQEVEYRAVLEYTGADVRVHVWTSRIGGSSFDLSYALEDHNGQ
FT                   VTAVGTTTIVVIGEGGRPVPLPAEARSRFGEVSGPPVEFRGR"
     gtgaccgctt ctcccgccag ccacccccag caagccgctt gcgtgcagat ccagcttcga        60
     ttcggcgaca tggacgcgct cgggcatgtc aacaatgtcg ccgtgctccg cgtcttcgaa       120
     gaggcccgcg tccgccttat ctccggacag ctccgcttag aaggcgtgag cgcgctggtc       180
     gcgcggcagg aagtggaata ccgcgctgtg ctggagtaca ccggagcaga tgtgcgcgtc       240
     cacgtctgga cgagccgcat aggcggatcg agcttcgacc tgtcctatgc gttggaggac       300
     cacaacggtc aggtcacggc cgttgggacc acgacaattg tggtcatcgg cgaaggcggg       360
     aggcccgtgc cccttcccgc cgaggcgcgg tcgcggttcg gcgaagtgtc cggccctcct       420
     gtcgaattcc gaggccgctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page