(data stored in ACNUC7421 zone)

EMBL: CP001958.PE187

CP001958.PE187       Location/Qualifiers
FT   CDS_pept        complement(172576..173118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0191"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   rer:RER_15470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96680"
FT                   /db_xref="GOA:D6ZAD8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD8"
FT                   /inference="protein motif:PFAM:PF02627"
FT                   /protein_id="ADG96680.1"
FT                   /translation="MAAQTRVALGGFRQIGPLAWAIDKAGARRLGVRHLRIMQALGRNK
FT                   RLFPFFVGYTGYFQGLSKIKLRNVELVILRVAHLRGSAYEWNHHVRLSARAKITAAEHE
FT                   RVAEGPGAAGWSPKEKALLTAVDGFVRQKSLGDEDFAELARHFDEAEIIEILLLTGAYD
FT                   SLATTIDIIGLQSEYED"
     atggccgcgc agacccgcgt cgcgctcggc ggttttcggc agatcggccc gctcgcatgg        60
     gccatcgaca aagcaggcgc gcgccgtctc ggcgtcaggc atctgcggat catgcaagcc       120
     ctcggccgca acaagcgcct cttccctttt ttcgtcgggt acaccgggta cttccagggg       180
     ctgtcgaaga tcaaactccg caacgtggaa ctcgtgatcc tgcgggtggc gcacctgcga       240
     ggctcggcct acgaatggaa ccaccacgtc cggctgagcg cccgcgcaaa aatcaccgcg       300
     gccgagcacg aacgcgtcgc cgaaggcccc ggcgccgcag ggtggagccc gaaagaaaaa       360
     gcactgctca ccgctgttga cggttttgtg cggcagaaat cgctcggcga cgaggacttc       420
     gccgaactcg cccggcactt cgacgaagct gagatcatcg agatcctgct gctcaccgga       480
     gcctacgact ccctggccac caccatcgac atcatcggcc tccaaagcga gtacgaggac       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page