(data stored in ACNUC7421 zone)

EMBL: CP001958.PE189

CP001958.PE189       Location/Qualifiers
FT   CDS_pept        173743..174237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sps:SPs0828 GRAB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96682"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96682.1"
FT                   /translation="MNIARRRPVARAWSAGVLPGVVLALTGACGAAAAVADVRDVCDEG
FT                   QRGVVDVKNSMQSFVEALGEYANATDEGKAERAAVGKFAWLAENSLRVAASRLDSVSSF
FT                   SQPGPITEKSEELVHQMRLLFDALGTNDYAFVDPVIDGYNDAAVGFMAACTGDPVGGDE
FT                   A"
     atgaacattg ctcgccgccg ccctgttgcg cgcgcctggt ccgccggggt gctgcccggt        60
     gttgttctcg cgttgaccgg tgcgtgcggc gctgccgcgg cggtggcgga cgtgcgggat       120
     gtgtgcgacg aagggcagcg cggcgtggtc gacgtcaaga acagcatgca gtcgttcgtc       180
     gaggcgctcg gcgagtacgc caacgccact gacgagggca aggccgaacg ggcggcggtc       240
     ggcaagttcg cttggctggc ggaaaactcg ttgcgggtcg ctgccagccg ccttgattcg       300
     gtgagcagct tcagccagcc cggcccgatc accgagaaga gcgaggagct cgtccaccag       360
     atgcgtttgt tgttcgacgc gctcggcacg aacgactacg cctttgtgga cccggtgatc       420
     gacgggtaca acgacgcggc ggtggggttc atggcggcgt gcacgggcga tcctgtcggc       480
     ggcgacgagg cctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page